PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G153400.1.p
Common NameDof25, Sb09g021690, SORBIDRAFT_09g021690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 367aa    MW: 38488.3 Da    PI: 5.9847
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G153400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1208.8e-3867121660
                zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                            +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  Sobic.009G153400.1.p  67 PSCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 121
                           58***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2848121IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.89167121IPR003851Zinc finger, Dof-type
PfamPF027019.8E-3268121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361069105IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MKLSSSSHHL LLESSNLTLS PHHRNTAVVT RMLSSHCENM LPYAPGRRAA VLLDHRRYRP  60
NVVEVAPSCP RCDSPNTKFC YYNNYSLSQP RYFCKGCRRY WTKGGSLRNV PVGGGCRKNR  120
RGKPVVRAVA VDAAVAAASG GASALANRSS SSSPATLRPD LLLEGMIGSP VGLCQPTDDD  180
AAEIPAVVAP EGSTIDLALL YAKFLNHQPA AAAEPCAAAV VPESLDTLSG SSTSGDVSPV  240
VVPPRDQHQP FTTQDHGGFG ELSATTASAE PSAAPPQRPA DDACACAAEA LIGALSVDPR  300
CYDSLGLPPD GGDLVLPSTW HLGTKYEPFD PLPEDAMSLQ DGFAGDEDVW SSALACQGLE  360
AALCRP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.202871e-37callus
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.009G153400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824160.0KC582416.1 Sorghum bicolor dof25 protein (dof25) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439872.10.0uncharacterized protein LOC8072499
TrEMBLC5YYR40.0C5YYR4_SORBI; Dof-type zinc finger protein 25
STRINGSb09g021690.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-35Dof family protein
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]