PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G143400.1.p
Common NameSb09g020850, SORBIDRAFT_09g020850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 564aa    MW: 63070.8 Da    PI: 4.5892
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G143400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS420.21.7e-1281935632374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL++cAea+s+ +  +aq+++++l++ ++ +gdp qR+aay++e+Laa +++s++++y+al+++e++   +  +l+a+++++e++P+
  Sobic.009G143400.1.p 193 KQLLFDCAEAISECSIDEAQSIITELRQKVAIQGDPSQRIAAYLVEGLAAAIQSSGKGIYRALRCKEAP---TLYQLSAMQILFEICPC 278
                           589*****************************************************************9...89999************ PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                           +++++++aN aIlea +gee vHiiDfdi+qG Q+++L+q+L + +++p  lRiTgv++pes+      l+ +g+rL+k+Ae ++vpfe
  Sobic.009G143400.1.p 279 FRLGFMAANYAILEACKGEEVVHIIDFDINQGSQYITLIQSLRNNSNKPRLLRITGVDDPESVhrAVGGLKVVGQRLEKLAEDCEVPFE 367
                           *************************************************************99888899******************** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                           f++ va ++ed+++ +L+++pgEal+Vn+++ lh+l+desvs+ ++rd++L++vk+l+Pk+v++veq+a++n+++Fl+rf e  +yysa
  Sobic.009G143400.1.p 368 FRA-VAANTEDVTPGMLDCRPGEALIVNFAFLLHHLPDESVSIVNQRDQLLRMVKGLQPKLVTLVEQDANTNTTPFLARFREVYDYYSA 455
                           ***.799********************************************************************************** PP

                  GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                           lfdsl+a+lpres +r++vEr++l+reivn++aceg +r+er e ++kWr+r+ +aGF p p+s+++ + +++ll+  + d yr e+ +
  Sobic.009G143400.1.p 456 LFDSLDATLPRESPDRMNVERQCLAREIVNILACEGPDRVERYEVAGKWRARMAMAGFAPCPFSSNVINGIRSLLKSSYCDKYRFEKVH 544
                           *******************************************************************************999******* PP

                  GRAS 356 gslvlgWkdrpLvsvSaWr 374
                           + l +gW d++Lv+ SaW+
  Sobic.009G143400.1.p 545 DGLHFGWGDKTLVFSSAWQ 563
                           ******************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.743166543IPR005202Transcription factor GRAS
PfamPF035145.9E-126193563IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MSFVRQADPS TSCAETTYIH KFVPPGSVFP AQRFVSGTDL VHYGPQPYNA EGYKQSAFNG  60
TVPHEFQNFY STDSYAESHF NEATYSPAIS NISQQNSQSL SDNQTSDLEV EFDEDEMRLK  120
LQELEHALLD DGDEIFSDFS GSIIDEWNDS IKKNNEWSNT MKDIVSPDSP KESSPESSLC  180
CLDSNIGEAR HPKQLLFDCA EAISECSIDE AQSIITELRQ KVAIQGDPSQ RIAAYLVEGL  240
AAAIQSSGKG IYRALRCKEA PTLYQLSAMQ ILFEICPCFR LGFMAANYAI LEACKGEEVV  300
HIIDFDINQG SQYITLIQSL RNNSNKPRLL RITGVDDPES VHRAVGGLKV VGQRLEKLAE  360
DCEVPFEFRA VAANTEDVTP GMLDCRPGEA LIVNFAFLLH HLPDESVSIV NQRDQLLRMV  420
KGLQPKLVTL VEQDANTNTT PFLARFREVY DYYSALFDSL DATLPRESPD RMNVERQCLA  480
REIVNILACE GPDRVERYEV AGKWRARMAM AGFAPCPFSS NVINGIRSLL KSSYCDKYRF  540
EKVHDGLHFG WGDKTLVFSS AWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-5819956226378Protein SCARECROW
5b3h_A7e-5819956225377Protein SCARECROW
5b3h_D7e-5819956225377Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.81510.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, shoots, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.009G143400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9485341e-148EU948534.1 Zea mays clone 379741 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439827.10.0scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLC5YY780.0C5YY78_SORBI; Uncharacterized protein
STRINGSb09g020850.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Representative plantOGRP82621116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]