PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G117800.1.p
Common NameSb09g018550, SORBIDRAFT_09g018550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 483aa    MW: 52169.4 Da    PI: 7.7216
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G117800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS240.66.5e-74804735374
                  GRAS   5 LlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                           + +c++ +++ ++e+a+++L  ls  +s dgdp+qRl++ f+eALa+r +   ++l+ +++ +  ++ + + +  a++ f+ + P+l+ 
  Sobic.009G117800.1.p  80 MQQCVTGMEAANTEAANSALVALSSASSLDGDPIQRLTSAFAEALARRALALLQGLSWSVQGQLRTPPSPAYAGVARQWFHSLNPLLRG 168
                           568**********************************************************9999999999999*************** PP

                  GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                           + l+aN+ I++avege+ vH++D++  ++ QW+ Ll+ La Rp+g+p slR+T v++    ++  l+   e L+  A++l++++  +++
  Sobic.009G117800.1.p 169 ASLAANHGIVRAVEGEQVVHVVDLGGANPRQWIELLRLLAGRPGGAPsSLRLTIVSE----HAFFLSCATELLTAEAARLHLSLAVHTV 253
                           *******************************************888879********....99*************************9 PP

                  GRAS 182 ..vakrledleleeLrvkpgEalaVnlvlqlhrll.........desvsleserdevLklvkslsPkvvvvveqeadhnse......sF 253
                             + +++++  l +L v++g al+ ++ lqlhrl          d+++++  + d +L+l+++lsPkv+v++eqeadhn++       +
  Sobic.009G117800.1.p 254 qaHIDNFSATVLASLGVQRGPALVLSSTLQLHRLIadtavvrhaDREHETMTRADVLLRLLRDLSPKVLVLTEQEADHNNGegrgagAL 342
                           77778999999************************88888888755555555799***********************7766899999* PP

                  GRAS 254 lerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                            +r+ +a++yy++lf+ l  +++pr s +r++vEr  l++ei+++va  ga+rrerhe++++W  r+ +aGF+pvp++ +   +a +l 
  Sobic.009G117800.1.p 343 WDRVNNAFDYYAVLFNELeVSGVPRGSLDRAVVERLHLREEIMDIVARDGAARRERHEKMQRWVPRMAAAGFQPVPVTMDGFREATRLD 431
                           ******************5567******************************************************************9 PP

                  GRAS 342 rkvk.sdg......yrve..eesgslvlgWkdrpLvsvSaWr 374
                           r+ + sd       yrv   +e g+++    + p++svS+W+
  Sobic.009G117800.1.p 432 RRRStSDAdrqrplYRVTavKEMGCFYVHSCSAPMFSVSFWQ 473
                           999866656677778877778899999999999999999995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.28750444IPR005202Transcription factor GRAS
PfamPF035142.2E-7180473IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MAPGNLDNKG KGKAVLNDDD DISAPTMPVE AIGSSGGQPA RSSAQAIPPA AAMAAPPLIH  60
RGSQSQQLDK SLIVLIKCVM QQCVTGMEAA NTEAANSALV ALSSASSLDG DPIQRLTSAF  120
AEALARRALA LLQGLSWSVQ GQLRTPPSPA YAGVARQWFH SLNPLLRGAS LAANHGIVRA  180
VEGEQVVHVV DLGGANPRQW IELLRLLAGR PGGAPSSLRL TIVSEHAFFL SCATELLTAE  240
AARLHLSLAV HTVQAHIDNF SATVLASLGV QRGPALVLSS TLQLHRLIAD TAVVRHADRE  300
HETMTRADVL LRLLRDLSPK VLVLTEQEAD HNNGEGRGAG ALWDRVNNAF DYYAVLFNEL  360
EVSGVPRGSL DRAVVERLHL REEIMDIVAR DGAARRERHE KMQRWVPRMA AAGFQPVPVT  420
MDGFREATRL DRRRSTSDAD RQRPLYRVTA VKEMGCFYVH SCSAPMFSVS FWQPAPPRDD  480
QQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-23794204329GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439699.10.0hypothetical protein SORBIDRAFT_09g018550
TrEMBLC5YX890.0C5YX89_SORBI; Putative uncharacterized protein Sb09g018550
STRINGSb09g018550.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1996722
MonocotsOGMP137161330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.12e-28scarecrow-like 3