PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G100500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family WRKY
Protein Properties Length: 517aa    MW: 53934.3 Da    PI: 7.9215
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G100500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46.2e-33217275260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           +DgynWrKYGqK+vkgse+prsYY+Ct+++C++kkkvers  d+++++i+Y+g Hnh+k
  Sobic.009G100500.2.p 217 EDGYNWRKYGQKQVKGSENPRSYYKCTYHSCSMKKKVERSLADGRITQIVYKGAHNHPK 275
                           8********************************************************85 PP

2WRKY105.62.5e-33385443159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDg++WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d+++v++tYeg+Hnh+
  Sobic.009G100500.2.p 385 LDDGFRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERASHDTRAVITTYEGKHNHD 443
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.9E-29211276IPR003657WRKY domain
PROSITE profilePS5081126.911211276IPR003657WRKY domain
SuperFamilySSF1182909.81E-26214276IPR003657WRKY domain
SMARTSM007741.0E-35216275IPR003657WRKY domain
PfamPF031061.3E-24217274IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-36370445IPR003657WRKY domain
SuperFamilySSF1182903.53E-29377445IPR003657WRKY domain
PROSITE profilePS5081138.124380445IPR003657WRKY domain
SMARTSM007743.6E-39385444IPR003657WRKY domain
PfamPF031061.5E-25386443IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MASSTGSLEH GGFTFTPPPF ITSFTELLSG TGDMLGGAGG ADQERSPRGL FHRGARGGVG  60
VPKFKSAQPP SLPISSPPPM SPSSYFAIPA GLSPAELLDS PVLLHSSSNI LASPTTGAIP  120
AQRFDWKQAA DLIASQSHQQ DDTRAAAAAG GFNDFSFHTA TTSNAMPAQT TSFPSFKEQQ  180
QQVEAAATTN KQSAVVASSN NKQGSSGGGN SSNTKLEDGY NWRKYGQKQV KGSENPRSYY  240
KCTYHSCSMK KKVERSLADG RITQIVYKGA HNHPKPLSTR RNSSSGGVVA AGEEQQAAAN  300
SLSAAAAAAG GCGPEHSGAT AENSSVTFGD DEAENASHRS DGDEPDAKRW KQEDGENEGS  360
SGGAGGKPVR EPRLVVQTLS DIDILDDGFR WRKYGQKVVK GNPNPRSYYK CTTVGCPVRK  420
HVERASHDTR AVITTYEGKH NHDVPVGRGA ASRAAAAAAV APTMGALMAA GGHQQQQQPY  480
TLEMLSGGVG GGAAYGGGYA AKDEPRDDLF VDSLLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-35204445177Probable WRKY transcription factor 4
2lex_A1e-35204445177Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.150230.0callus| embryo| ovary| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9557840.0EU955784.1 Zea mays clone 1545969 WRKY53 - superfamily of TFs having WRKY and zinc finger domains mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147551.10.0WRKY53 - superfamily of TFs having WRKY and zinc finger domains
SwissprotQ8S8P51e-104WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLB6SSR90.0B6SSR9_MAIZE; WRKY53-superfamily of TFs having WRKY and zinc finger domains
STRINGSb09g015900.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.11e-93WRKY DNA-binding protein 26