PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G025900.1.p
Common NameSb09g002190, SORBIDRAFT_09g002190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 220aa    MW: 22816.1 Da    PI: 6.692
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G025900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.21.2e-42381371100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+C++ Cvlapyfp ++p+kfa +h++FGasn++kll++lpee+r da+ss+vyeA ar+rdPvyG++g i +lq+q+++
  Sobic.009G025900.1.p  38 PCAACKILRRRCVDRCVLAPYFPPTEPHKFATAHRVFGASNIIKLLQELPEEHRADAVSSMVYEAAARIRDPVYGCAGAICQLQKQVNE 126
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           lka+la++++e
  Sobic.009G025900.1.p 127 LKAQLARAHAE 137
                           *******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.00237138IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4238135IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MDCSSDTAVC AVAVAAATAQ SPPSSPQPAA AAAVVLSPCA ACKILRRRCV DRCVLAPYFP  60
PTEPHKFATA HRVFGASNII KLLQELPEEH RADAVSSMVY EAAARIRDPV YGCAGAICQL  120
QKQVNELKAQ LARAHAELAG ARAQHAHLLA LLCVEVAATA SPPSYCGAAD YSSSSHHQLA  180
VVANPMMAAD ALYVVDGAGA ALQMQVGSPV SWADEALWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-443713810111LOB family transfactor Ramosa2.1
5ly0_B3e-443713810111LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.86380.0leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.009G025900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9539371e-93EU953937.1 Zea mays clone 1449845 LOB domain protein 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440509.11e-156LOB domain-containing protein 1
SwissprotQ9SK082e-61LBD11_ARATH; LOB domain-containing protein 11
TrEMBLC5YZ341e-155C5YZ34_SORBI; Uncharacterized protein
STRINGSb09g002190.11e-156(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-48LOB domain-containing protein 1