PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G014400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 386aa    MW: 39250.5 Da    PI: 8.9999
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G014400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1183.7e-37101159361
                zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                           e  lkcprCdstntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  Sobic.009G014400.1.p 101 EPGLKCPRCDSTNTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 159
                           56789************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3984158IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.789104158IPR003851Zinc finger, Dof-type
PfamPF027018.4E-32104158IPR003851Zinc finger, Dof-type
PROSITE patternPS013610106142IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MIFPPAFLDS SSWNDNQHQH HHQQQQQQQA HHQHQVAANA GGGGGGGDAN HELLQQSIMG  60
GPLPDGGGGG GGGAGGQVVG GPAKPMSMAE RARLARIPLP EPGLKCPRCD STNTKFCYFN  120
NYSLSQPRHF CRACRRYWTR GGALRNVPVG GGYRRHAKRA KPKQQQAAGA GAGGGSAGTG  180
NTATANAALQ HAPAGSTASS AAACTATTTN ALPGGMLGGG GLSMLPPLLR LADFDAMSLG  240
STFSGISSMG KPGSIDAYSH SVGGGGAPAG LEQWRVQQMQ SFPFLHAMDQ GPLGPPLAMA  300
MAAPGMFQLG LDTTSSDNGH GRGGGGGEDG STGGELHVMH QQAATKRESY PAPRGMYGDH  360
HHHLAAAGGY TSAYSTNAAT GNHLL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.009G014400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824170.0KC582417.1 Sorghum bicolor dof26 protein (dof26) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021302581.10.0dof zinc finger protein DOF5.1-like
TrEMBLA0A1B6P6270.0A0A1B6P627_SORBI; Uncharacterized protein
STRINGGRMZM2G179069_P011e-132(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.12e-41OBF-binding protein 3