PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G011200.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 742aa    MW: 84441.2 Da    PI: 6.9587
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G011200.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3435e-1053637331374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lL +cA+av+++d  la +l++++++++s dgd  qRla+yf+++L+arla+++s+l++++ +++ s    +++l +++++  v+P
  Sobic.009G011200.3.p 363 LRTLLNHCAQAVAADDRLLAGELIKKIRQHSSRDGDCCQRLAFYFVNGLEARLAGTGSQLFHKVLAKRIS---DEDVLRVYNFYLTVCP 448
                           5789**********************************************************99999988...7899999********* PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           +l+ s+  aNq+Il+a  g+++vH++ +++ +G+QWp+L+q + ++ + pp+lRiTg++ p++g    e++e+ g+ +a++A+  +vpf
  Sobic.009G011200.3.p 449 FLRASYTFANQTILQASVGQSKVHVVEIGVCYGFQWPSLIQLFGEQ-GVPPRLRITGIEVPRPGftPLENIERAGKLMADYANMYKVPF 536
                           ********************************************95.889*************9999********************** PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           +++  + +r ed+++e+L+++++E+l++n+++q+++l de+v+++s+rd+vLk++++++Pkv+++   +  ++s+ F++rf e l +ys
  Sobic.009G011200.3.p 537 QYQG-IYSRYEDIQIEDLNIEEDEVLIINCMYQMKNLGDETVAIDSARDRVLKIMRRMNPKVLIFGILNGLYSSPFFMTRFKELLFHYS 624
                           ****.799********************************************************************************* PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           ++fd+l++++pr++eer+ +E  +lgrei n+vacega+r+er et+++W+ r  +aGF+++pl+  ++k++ l+ ++++ + +  +e+
  Sobic.009G011200.3.p 625 SIFDMLDTNAPRDNEERKLLEGGMLGREILNIVACEGADRIERPETYQQWQGRCLKAGFEQLPLDPAVMKSMLLMKKEIYHEHFVADED 713
                           ********************************************************************************999****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                           +g+l++gWk+r L+++S W+
  Sobic.009G011200.3.p 714 NGWLLQGWKGRVLYALSKWK 733
                           *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.774337713IPR005202Transcription factor GRAS
PfamPF035141.7E-102363733IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MLIECPFDDL YTLTTPGQQQ DGSSSSQQQL TLSDHRLCDP QFFSQSTNES NMQFSAVVTI  60
PRMYNVSSNL GQNHLQIAAG VSPDYQRIRS NNALHHISQI LMEDVDERVG LHEGEAALQA  120
AEKAFFDILE QVNPPSLDWS PLHHSGEAGE GPGEGSNSYH KRPRRSSFTT DISSHSMFFE  180
ESSHRMLQPL PAPLIPNSYG RSLFLPYQQP LASTGRTSRF GFSALEIRRE AEDGNRFDKM  240
VICLEKDKLS ICRLTTTKAK IVARKSKYAI FQITDYRNSP YIQDSDTREG RSKNYTITCE  300
ISRNEKFDRV LLCYGLDCFI ETARLRDMAA KEASETSPKG QSKTPARQKL RGTRQLKKEV  360
VDLRTLLNHC AQAVAADDRL LAGELIKKIR QHSSRDGDCC QRLAFYFVNG LEARLAGTGS  420
QLFHKVLAKR ISDEDVLRVY NFYLTVCPFL RASYTFANQT ILQASVGQSK VHVVEIGVCY  480
GFQWPSLIQL FGEQGVPPRL RITGIEVPRP GFTPLENIER AGKLMADYAN MYKVPFQYQG  540
IYSRYEDIQI EDLNIEEDEV LIINCMYQMK NLGDETVAID SARDRVLKIM RRMNPKVLIF  600
GILNGLYSSP FFMTRFKELL FHYSSIFDML DTNAPRDNEE RKLLEGGMLG REILNIVACE  660
GADRIERPET YQQWQGRCLK AGFEQLPLDP AVMKSMLLMK KEIYHEHFVA DEDNGWLLQG  720
WKGRVLYALS KWKVNELCAD Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-503637335375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.009G011200.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7276930.0KJ727693.1 Zea mays clone pUT5632 GRAS transcription factor (GRAS57) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021303190.10.0scarecrow-like protein 9
TrEMBLC5YYG60.0C5YYG6_SORBI; Uncharacterized protein
STRINGSb09g001160.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-151GRAS family protein