PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G011100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 627aa    MW: 71176.9 Da    PI: 6.7903
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G011100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3741.9e-1142526221374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l+ lL++cA+a+ss+++  a++lL+++++++sp+gd +qRla yf+ AL+ar+a+++s++y++l +++ts     + l+a++lf  +sP
  Sobic.009G011100.2.p 252 LRALLIQCAQAISSNNHPFASELLKKIRHHSSPYGDGFQRLAIYFADALEARVAGTGSQMYQKLVVKQTS---CLDMLKAYSLFIAASP 337
                           5789*****************************************************************9...9*************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           ++++++   N++I++ + g  rvHiiDf+i  G+QWp+L+q La+R++gpp+lRiTg++ pe+g    +++eetg+rLa++A+ ++vpf
  Sobic.009G011100.2.p 338 FVRVAYYFGNKTIVDVLGGRPRVHIIDFGILFGFQWPSLIQRLAKREGGPPQLRITGINVPETGfrPCKTIEETGKRLAEYARMFNVPF 426
                           **************************************************************999999********************* PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           +++  va+r+ed+ + +L+++++E+l+Vn+ +++++l de+ +++s+rd+vL+++k+++P+v+++   +  ++s+ Fl rf eal yys
  Sobic.009G011100.2.p 427 QYQG-VASRWEDIYIPDLNIDKDEVLIVNCLHKMKNLGDETEDIDSARDRVLRIMKRMNPNVLIIGVMNGLYSSPFFLPRFREALFYYS 514
                           ****.7*********************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           + fd+l++++++++e+ri +Er llg ++ nvvacegaer+er e++++W+ r+ +aGFk++p+++++ k+     + +++d + ++e+
  Sobic.009G011100.2.p 515 SQFDMLNSTVAQNHEARILIERDLLGADVFNVVACEGAERIERPESYKQWQVRILKAGFKQLPVNQTILKSSLDRKELYHED-FVIDED 602
                           ***********************************************************************99999999966.****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                           sg+l++gWk+r + ++S+W+
  Sobic.009G011100.2.p 603 SGWLLQGWKGRIMHALSSWK 622
                           *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.568226603IPR005202Transcription factor GRAS
PfamPF035146.6E-112252622IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MDNPEYCEIN SNITLNYVNQ LLMEESADEN ISTYKHHDAL QAMEKPFYDI LGKAYPSSPK  60
QTVINSGSQS NFPDDINNNY HDLECSGSSV SDILGCKAVR LIDIDGGSEL CNVVLQFNRT  120
AEEARKLVPS IEKLVVDPES NGLSSSKQTI EATIGQHSKH TNKIRSHPHV DLELVERRNS  180
KHSAISTSEI IRDEIFDRVL LCDEQYHCDV AHLREMKAKE ANISLQYVRN TGSAQGKEKS  240
QGKKQEKEEV DLRALLIQCA QAISSNNHPF ASELLKKIRH HSSPYGDGFQ RLAIYFADAL  300
EARVAGTGSQ MYQKLVVKQT SCLDMLKAYS LFIAASPFVR VAYYFGNKTI VDVLGGRPRV  360
HIIDFGILFG FQWPSLIQRL AKREGGPPQL RITGINVPET GFRPCKTIEE TGKRLAEYAR  420
MFNVPFQYQG VASRWEDIYI PDLNIDKDEV LIVNCLHKMK NLGDETEDID SARDRVLRIM  480
KRMNPNVLII GVMNGLYSSP FFLPRFREAL FYYSSQFDML NSTVAQNHEA RILIERDLLG  540
ADVFNVVACE GAERIERPES YKQWQVRILK AGFKQLPVNQ TILKSSLDRK ELYHEDFVID  600
EDSGWLLQGW KGRIMHALSS WKRKDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-562376214378Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.009G011100.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280160.0KJ728016.1 Zea mays clone pUT6152 GRAS transcription factor (GRAS6) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440450.20.0scarecrow-like protein 9
TrEMBLA0A1B6P5S10.0A0A1B6P5S1_SORBI; Uncharacterized protein
STRINGSb09g001140.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-162GRAS family protein