PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G011000.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 624aa    MW: 71096.7 Da    PI: 5.9122
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G011000.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.71.3e-1112456152374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           +  L++cA+a+  ++l  a+ lL++++ +asp+gd  qRla y++++L arla+++s++y++l  ++t+    ++ l+a++lf  v+P+
  Sobic.009G011000.4.p 245 RAHLMQCAQAIVVNNLPFASDLLEKIRCHASPYGDGSQRLALYLANGLDARLAGTGSHVYQKLMEKRTR---ATDMLKAYRLFIAVCPF 330
                           678************************************************************999998...99*************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                            k+++   Nq+I++  +g  +vHiiDf+i+ G+QWp+L+q +a+R++gpp+lRiTg+++p++g   +  +e+tg+rLa++Ae ++vpfe
  Sobic.009G011000.4.p 331 SKVAYYFSNQTIVDLSNGRPKVHIIDFGITLGFQWPSLIQRFAKREGGPPKLRITGIDAPQPGfrPRAIIEATGKRLAEYAEMFNVPFE 419
                           ***************************************************************999999******************** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                           ++  +a+++ed+ +e+L+++++E+l+Vn++++ ++l de+ +++s+rd+vL+++k+++P+v+++   +  ++s+ Fl rf e l +ysa
  Sobic.009G011000.4.p 420 YQG-IASQWEDICIENLNIDNDEVLIVNCMYRTKYLGDETEDIDSARDRVLRTMKRINPEVLILGVLNGLYSSPFFLPRFREVLFHYSA 507
                           ***.7************************************************************************************ PP

                  GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                           lfd+l+a++ r +e+ri +Er l+g+e+ nvvacegaer+er et+++W+ r  +aGFk++p+++ + k      +k++ +g+ ++e+s
  Sobic.009G011000.4.p 508 LFDMLDATALRSHEDRIQLERDLFGPEALNVVACEGAERIERPETYKQWQVRCLKAGFKQLPVDKAILKRSIDEKNKHYHEGFVIDEDS 596
                           ********9************************************************************99999999999********* PP

                  GRAS 356 gslvlgWkdrpLvsvSaWr 374
                            +l++gWk+r + +vS+W+
  Sobic.009G011000.4.p 597 RWLLQGWKGRIMHAVSSWK 615
                           ******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.277218595IPR005202Transcription factor GRAS
PfamPF035144.4E-109245615IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MESPEYCEIN SNMTLDYINQ LLMDEGTDEK DSIYQQFDAL QAIEKPFYDI LGQTYPSSPK  60
ETMISGDTEV DCPQDNYSKQ ARSGCFVNDV LGPQGTHLVT HDWTSECDRL SLQFERGAEE  120
ANKLVPSIVK LVDLDSNGLS DSNQMIEATI GQKGKHVSKI RSHVDLEFLE ARNSKHLAIS  180
ASETTRDEMF DSVLLCDWQF NCDAAHLREI KEKQANNSSQ NVWRKGYGQG QVKLRVKKEE  240
GIDLRAHLMQ CAQAIVVNNL PFASDLLEKI RCHASPYGDG SQRLALYLAN GLDARLAGTG  300
SHVYQKLMEK RTRATDMLKA YRLFIAVCPF SKVAYYFSNQ TIVDLSNGRP KVHIIDFGIT  360
LGFQWPSLIQ RFAKREGGPP KLRITGIDAP QPGFRPRAII EATGKRLAEY AEMFNVPFEY  420
QGIASQWEDI CIENLNIDND EVLIVNCMYR TKYLGDETED IDSARDRVLR TMKRINPEVL  480
ILGVLNGLYS SPFFLPRFRE VLFHYSALFD MLDATALRSH EDRIQLERDL FGPEALNVVA  540
CEGAERIERP ETYKQWQVRC LKAGFKQLPV DKAILKRSID EKNKHYHEGF VIDEDSRWLL  600
QGWKGRIMHA VSSWKPKESY TNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A6e-542316175380Protein SCARECROW
5b3h_D6e-542316175380Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.009G011000.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270160.0KJ727016.1 Zea mays clone pUT3997 GRAS transcription factor (GRAS60) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021303378.10.0scarecrow-like protein 9
TrEMBLA0A1B6P5S00.0A0A1B6P5S0_SORBI; Uncharacterized protein
STRINGGRMZM2G089636_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-163GRAS family protein