PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G174650.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NF-YA
Protein Properties Length: 386aa    MW: 41633.4 Da    PI: 9.594
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G174650.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.63.1e-31219275158
             CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                           ++p+YVNaKQy++I++RR +Rak+e+e++l  k+rkpylheSRh+hAlrRpRgsgGrF
  Sobic.008G174650.2.p 219 EAPIYVNAKQYDAIMRRRRARAKAERENRL-VKARKPYLHESRHQHALRRPRGSGGRF 275
                           57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-35217278IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.881218278IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.6E-23221243IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.2E-27221275IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860223243IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.6E-23252275IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MLTPLFILLL LFIVAYSSSW VVVRLGTVPS PTSLVNVAST STSKTSKMMS FRSTTHDGFV  60
GHAAVNGAGA PVPWWAGAPM LCGEPLGLGR PVVAAFSPED HCRDGRFQVL QGPPLDPLVP  120
SLKAPVAHQQ QTEKGLSAEL LNLSVAHQGK GKKGSEHSAT VALQSPFAIY NGRFELGLGQ  180
SMISADNSYA DQHYGLISPY PMGATPGGRM LIPLNMPTEA PIYVNAKQYD AIMRRRRARA  240
KAERENRLVK ARKPYLHESR HQHALRRPRG SGGRFLNTKK ESDGKDAGGG SKATFSNPLM  300
RQVASPSSEI QHSDLGNPSS VSSLSGSEVS SMYDREDMDH YHSFDHLRTP FFTPLTSIMD  360
GDHGVVGNPF KWAAASEVCC DLLKA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A2e-18219276260HAPB protein
4g91_A2e-18219276260HAPB protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.12530.0callus
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0678270.0BT067827.1 Zea mays full-length cDNA clone ZM_BFc0168D11 mRNA, complete cds.
GenBankBT0338110.0BT033811.1 Zea mays full-length cDNA clone ZM_BFc0155E11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130553.11e-164uncharacterized protein LOC100191652
TrEMBLB4FXN41e-169B4FXN4_MAIZE; Uncharacterized protein
STRINGSb08g021910.11e-150(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.36e-27nuclear factor Y, subunit A10