PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G168400.1.p
Common NameSb08g021375, SORBIDRAFT_08g021375
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 526aa    MW: 56665.4 Da    PI: 6.551
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G168400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS327.72.2e-100864751373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                           lv+lL++c  a+++gd + a+  L++ + +    p+ + + R+ ++ft ALa+rl+   ++ ++  ++ + +     +  a ++ f+++
  Sobic.008G168400.1.p  86 LVHLLITCTGAIQAGDYSVAHGNLTEARAIlkKIPTSTGIGRVGTHFTDALAQRLFPAYPHAAALPSCLPPA-----TPPATYNHFYDA 169
                           68**************************998788999********************888888666666665.....56678899**** PP

                  GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                            P+lkf++ +aN+aIl+a+eg++rvHiiDf ++qGlQWpaL+++L++R++gpp+lRiTg+g++ ++ ++el+e+g rLa+fA+ +++pf
  Sobic.008G168400.1.p 170 GPYLKFAYSAANRAILKAFEGCKRVHIIDFALMQGLQWPALMEELSKREGGPPELRITGIGPNPTSGRDELHEVGVRLAEFARYMKIPF 258
                           **************************************************************9888*********************** PP

                  GRAS 177 efnvlvakrledlele.eLrvkpgEalaVnlvlqlhrlldesvsles....erdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                            f+ + a++l+ l+ + +L+++p+Eala n++lqlhrll ++ + es    ++d +Lklv +l+Pk+++vveqeadhn++++lerf++a
  Sobic.008G168400.1.p 259 TFQGVCADHLDHLTAWiHLKLRPDEALAMNSILQLHRLLVDPDADEStmpaPIDILLKLVVKLKPKIFTVVEQEADHNKPRLLERFTNA 347
                           *************98857*********************66555555444599************************************ PP

                  GRAS 261 leyysalfdsleak............lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls.ekaakq 336
                           l +y+++fdslea              ++++++ +++ +++l+ ei ++++ eg++r erhe    W+erl++aGF++v+++ ++a+++
  Sobic.008G168400.1.p 348 LFHYATMFDSLEAVcsavnvsaaaarSSTNTSTTSSLAEAYLRGEIFDIICGEGNARLERHELCTAWNERLTRAGFTQVEFNlSEANME 436
                           ***********999999999998654444448888999999**************************************9975678899 PP

                  GRAS 337 aklllrkvk..sdgyrveeesgslvlgWkdrpLvsvSaW 373
                           +  l+++ +  + g+ + + sg l l W++rpL++++aW
  Sobic.008G168400.1.p 437 ITELINESSfsGAGFDILQGSGGLALAWQGRPLYVATAW 475
                           99999988844677************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.76360453IPR005202Transcription factor GRAS
PfamPF035147.5E-9886475IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MGHIPFTWLP MNPDAAAATL TADAAVPAAP IPIPTPTTTT DAAAMQHYYL NSWLHASLMQ  60
PAVVQTATEE ARRRQDQEEE AASIRLVHLL ITCTGAIQAG DYSVAHGNLT EARAILKKIP  120
TSTGIGRVGT HFTDALAQRL FPAYPHAAAL PSCLPPATPP ATYNHFYDAG PYLKFAYSAA  180
NRAILKAFEG CKRVHIIDFA LMQGLQWPAL MEELSKREGG PPELRITGIG PNPTSGRDEL  240
HEVGVRLAEF ARYMKIPFTF QGVCADHLDH LTAWIHLKLR PDEALAMNSI LQLHRLLVDP  300
DADESTMPAP IDILLKLVVK LKPKIFTVVE QEADHNKPRL LERFTNALFH YATMFDSLEA  360
VCSAVNVSAA AARSSTNTST TSSLAEAYLR GEIFDIICGE GNARLERHEL CTAWNERLTR  420
AGFTQVEFNL SEANMEITEL INESSFSGAG FDILQGSGGL ALAWQGRPLY VATAWHAMGG  480
GNAASAAIAH TKEGDSYQKG KNSSGSGGGK GNRGRCGVAG GITFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-38864764375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443550.10.0hypothetical protein SORBIDRAFT_08g021375, partial
TrEMBLC5YRY60.0C5YRY6_SORBI; Putative uncharacterized protein Sb08g021375 (Fragment)
STRINGSb08g021375.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.11e-81GRAS family protein