PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G168300.1.p
Common NameSb08g021370, SORBIDRAFT_08g021370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NF-YA
Protein Properties Length: 214aa    MW: 23173.4 Da    PI: 8.697
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G168300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.11.2e-32108164158
             CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                           +ep+YVNaKQy++Il+RRq+Rak+e+e+kl  k+rkpylheSRh+hAl+R+Rg gGrF
  Sobic.008G168300.1.p 108 EEPVYVNAKQYNAILRRRQSRAKAESERKL-VKGRKPYLHESRHQHALKRARGAGGRF 164
                           69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.0E-35106167IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.53107167IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.5E-27109164IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-23110132IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860112132IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-23141164IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MTSVVQSVSG DHRAEDQHHQ KKQAEPGDQQ EAPVTSSDSQ PTVGTPSTDY VAPYAPHDMS  60
HAMGQYAYPN IDPYYGSLYA AYGGQPLMHP PLVGMHPAGL PLPTDAIEEP VYVNAKQYNA  120
ILRRRQSRAK AESERKLVKG RKPYLHESRH QHALKRARGA GGRFLNSKSD DKEENSDSSH  180
KEKQNGVAPN NGQPSTPPSP NGASSANQAG SRE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-21107171165NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.33630.0embryo| shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9699190.0EU969919.1 Zea mays clone 337251 nuclear transcription factor Y subunit A-7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443549.11e-155hypothetical protein SORBIDRAFT_08g021370
SwissprotQ84JP17e-46NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLC5YRY51e-155C5YRY5_SORBI; Putative uncharacterized protein Sb08g021370
STRINGSb08g021370.11e-155(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6801672
MonocotsOGMP65553853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.27e-40nuclear factor Y, subunit A7