PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G148101.1.p
Common NameDof1, Sb08g019830, SORBIDRAFT_08g019830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 276aa    MW: 28033.9 Da    PI: 9.9873
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G148101.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.24.8e-354397559
                zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                            +cprC s++tkfCyynny+++qPr+fC+aCrryWt GG+lrnvPvGg++rk+ 
  Sobic.008G148101.1.p 43 REQCPRCASRDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNVPVGGSTRKRP 97
                          579*************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.4E-304496IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.6154498IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-214591IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MEAPLHQFPV PPPLPQDALL RQQAVAARAL MVAATAGNKA AGREQCPRCA SRDTKFCYYN  60
NYNTAQPRHF CRACRRYWTL GGSLRNVPVG GSTRKRPRPR PARHTRAMAA AAFGAAAMAT  120
PSTTTTASDG GSPFASPATF QGVGGGGGLL LSSLLLGSVS ASSSASPLLA LGAAPLLEGR  180
LGFDLGFGDA ALGGGGGGGA HAADLPHHHQ LPLGGGPPLL PWPAATTRIL EGDRAETTTV  240
FPFPPAGAVW QELAATAPVV EAAGLHHGGA PHLLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19399RKRPRPR
29498KRPRP
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.008G148101.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5400840.0HQ540084.1 Sorghum bicolor clone SbDof1 Dof-type zinc finger protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443463.10.0dof zinc finger protein DOF1.6
TrEMBLC5YQW30.0C5YQW3_SORBI; Dof-type zinc finger protein
STRINGSb08g019830.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.15e-24Dof family protein
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]
  2. Kushwaha H, et al.
    Cloning, in silico characterization and prediction of three dimensional structure of SbDof1, SbDof19, SbDof23 and SbDof24 proteins from Sorghum [Sorghum bicolor (L.) Moench].
    Mol. Biotechnol., 2013. 54(1): p. 1-12
    [PMID:22476870]