PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G138600.1.p
Common NameSb08g018940, SORBIDRAFT_08g018940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 731aa    MW: 80545.8 Da    PI: 5.0994
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G138600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS357.91.5e-1093507211373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lL++cA+av+s+d + a++lL +++++asp+gd++qRla++f+e+L+arla+++s +y++l +++ts    ++ l+a++l+  +  
  Sobic.008G138600.1.p 350 LRTLLVHCAQAVASDDRRSATELLRQIKQHASPQGDATQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AADILQAYQLYMAAIC 435
                           6789************************************************************999998...9*************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           + k+ ++  N++I++a+ g++++Hi+ ++i++G+QWp++l+ +a+R++gpp++RiTg++ p++g   ++++eetg+rL+k+A+++gvpf
  Sobic.008G138600.1.p 436 FKKVVFVFSNHTIYNAALGKKKIHIVEYGIQYGFQWPCFLRWIADREGGPPEVRITGIDLPQPGfrPTQRIEETGRRLSKYAQQFGVPF 524
                           ***************************************************************9************************* PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           ++++++a+++e+++ e+L+++p+E+l+Vn+ +q ++l+desv +es+rd vL+ +++++P+ ++++  + + +++ F++rf eal +ys
  Sobic.008G138600.1.p 525 KYQAIAASKMESIRAEDLNLDPEEVLIVNCLYQFKNLMDESVVIESPRDIVLNNIRKMRPHTFIHAIVNGSFSAPFFVTRFREALFFYS 613
                           ***************************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           alfd+l+a+ pr+s++r+ +E+ l+gr++ nv+aceg++r+er et+++W+ r ++aG+k+ pl+ ++++ ++  ++ ++ + + ++ +
  Sobic.008G138600.1.p 614 ALFDALDATTPRDSNQRMLIEENLFGRAALNVIACEGTDRVERPETYKQWQVRNQRAGLKQQPLNPDVVQIVRNKVKDCYHKDFVIDVD 702
                           ********************************************************************************889****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaW 373
                           +++l++gWk+r L+++S W
  Sobic.008G138600.1.p 703 HHWLLQGWKGRILYAISTW 721
                           ******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.154324702IPR005202Transcription factor GRAS
PfamPF035145.3E-107350721IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MGSSYYDPSP SPGADELFLY LSDLGPTSPS AYLDLPPTSP SAYLDLPPTP QGNTTGPKQD  60
MLLPYISSML MEDDIDDTFF YDYPDNPALL QAQQSFLDIL SDDASSPTTT TTTHSGASAS  120
VNHNCSSCSS DAFDASASAP LTPAAVDSYV SAPAPATHFD GFDLDPAAFF SNGANSDLMS  180
SAFLKGMEEA NKFLPTQDKL VIDLDPPDDP KRFVLPTPTP APAADKLAPG FNAATVPAAV  240
AVKEEVIFAA PDAAPGSGAV LGRGRRNRFD DDDDPELQHR SSKQSALQGD GDERDVFEKY  300
ILTSPEMCTE QMQKLRIAMQ EEAAKQEKAA AAAGNGKAKG RRGGRDVVDL RTLLVHCAQA  360
VASDDRRSAT ELLRQIKQHA SPQGDATQRL AHCFAEGLQA RLAGTGSMVY QSLMAKRTSA  420
ADILQAYQLY MAAICFKKVV FVFSNHTIYN AALGKKKIHI VEYGIQYGFQ WPCFLRWIAD  480
REGGPPEVRI TGIDLPQPGF RPTQRIEETG RRLSKYAQQF GVPFKYQAIA ASKMESIRAE  540
DLNLDPEEVL IVNCLYQFKN LMDESVVIES PRDIVLNNIR KMRPHTFIHA IVNGSFSAPF  600
FVTRFREALF FYSALFDALD ATTPRDSNQR MLIEENLFGR AALNVIACEG TDRVERPETY  660
KQWQVRNQRA GLKQQPLNPD VVQIVRNKVK DCYHKDFVID VDHHWLLQGW KGRILYAIST  720
WVANDAPSYF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-393547218374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277580.0KJ727758.1 Zea mays clone pUT5702 GRAS transcription factor (GRAS50) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442368.10.0hypothetical protein SORBIDRAFT_08g018940
TrEMBLC5YQA70.0C5YQA7_SORBI; Putative uncharacterized protein Sb08g018940
STRINGSb08g018940.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-156GRAS family protein