PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G136100.1.p
Common Namedof28, Dof28, Sb08g018760, SORBIDRAFT_08g018760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 341aa    MW: 34557.6 Da    PI: 8.8762
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G136100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.8e-38108165562
                zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           +l+cprCdstntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+s
  Sobic.008G136100.1.p 108 TLRCPRCDSTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRS 165
                           679***************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3290161IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.385109163IPR003851Zinc finger, Dof-type
PfamPF027011.2E-31109163IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MVFSSLPIFL DPPSWGQMQM QQQPPLQCLL GGGGGGSDHH HLMPPPSGLA PLPGGPADTA  60
ASAPAGGGSS TSMQAAAGAG TAAAQPRPVV SMAERARLAR VPLPEPGTLR CPRCDSTNTK  120
FCYFNNYSLS QPRHFCKACR RYWTRGGALR NVPVGGGCRR NTKRSSKKSS RGGGGAGATA  180
ATSSSSTTST STTATTTTAT TTSAAMAAAE AIASMQAQLP HLGLPPAAAA AALEASLEGY  240
HHYLPLQMQP QFLQQAGLHG YHFADDGTGV LADGFPRGVV ASGLLAQLAA VKMEEHSSNG  300
GGAVAAHHEQ SYWPGSTGGG SGWPAEFLSG FSSSSSGNVL *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.008G136100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824190.0KC582419.1 Sorghum bicolor dof28 protein (dof28) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442354.20.0dof zinc finger protein DOF2.4
TrEMBLA0A1Z5R6M50.0A0A1Z5R6M5_SORBI; Uncharacterized protein
STRINGSb08g018760.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.19e-40Dof family protein
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]