PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G073200.4.p
Common NameSb08g006490, SORBIDRAFT_08g006490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family ZF-HD
Protein Properties Length: 329aa    MW: 34724.7 Da    PI: 9.1395
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G073200.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.74.8e-3276129357
           ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                           +vrY+eClkNhAa++Gg a+DGCgEfmp+ geeg+ +al+C+ACgCHRnFHR+e+
  Sobic.008G073200.4.p  76 GVRYRECLKNHAAAIGGSATDGCGEFMPA-GEEGSLDALRCSACGCHRNFHRKEP 129
                           69**************************9.999********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.1E-2977129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.8E-3078128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-2278128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.68279128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.03E-19211284IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-30212284IPR009057Homeodomain-like
TIGRFAMsTIGR015655.1E-27223279IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MDLSGTQGEL PMAMHAGGGG GGSPYLGLHH GHHEQQHNHG ANGRHMSPPD VVAEEAKNRQ  60
LAVVPVSGAG GGGGAGVRYR ECLKNHAAAI GGSATDGCGE FMPAGEEGSL DALRCSACGC  120
HRNFHRKEPP GGGGGGDARQ LHGHGHHHHH HHPLSPLSPL AAAHHHRGLL VAALPPAPTR  180
MVMPLSAMHH QQQHHNSSAS AESDDAHNAP GHAHGQQQGP PARKRFRTKF TAEQKARMLG  240
FAEEAGWRLQ KLDDAAVQRF CQEVGVKRRV LKVWMHNNKH TLARRGHDGV GDPQQQGPHG  300
GQLGMPLPEP GGPGRSPSRS PPPQLRLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-242242811875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9655081e-150EU965508.1 Zea mays clone 286516 mRNA sequence.
GenBankBT0655691e-150BT065569.1 Zea mays full-length cDNA clone ZM_BFb0298N18 mRNA, complete cds.
GenBankBT0650051e-150BT065005.1 Zea mays full-length cDNA clone ZM_BFc0120L10 mRNA, complete cds.
GenBankBT0432581e-150BT043258.1 Zea mays full-length cDNA clone ZM_BFc0135C02 mRNA, complete cds.
GenBankJX4285001e-150JX428500.1 Zea mays subsp. mays clone pUT3098 ZHD21 ZF-HD type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443023.10.0hypothetical protein SORBIDRAFT_08g006490
SwissprotQ2QW443e-79ZHD3_ORYSJ; Zinc-finger homeodomain protein 3
TrEMBLC5YTM10.0C5YTM1_SORBI; Putative uncharacterized protein Sb08g006490
STRINGSb08g006490.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.28e-54homeobox protein 31