PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G046700.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 498aa    MW: 53622.9 Da    PI: 4.5874
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G046700.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2085.4e-641154943373
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lL++ A+av+s+d+  a+a+L+r+     ++      la yf+++L++r+++++ +       ++++     +++ a+++++e+sP++
  Sobic.008G046700.3.p 115 DLLVAGARAVESRDAISASAILSRIDAALVSS---SDHLACYFARGLRSRISGECRS-------TADDAAAPGNRMPAYRMLQELSPFI 193
                           689**********************9985543...4579**************3333.......3333334678899************ PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiT.gvgspesg.skeeleetgerLakfAeelgvpfef 178
                           kf+h+taNqaIlea++ + +vH++D+++++G+QW++L+  La R ++  ++R+T +++ ++++  + + ++ g+ L++fA++l+vpf++
  Sobic.008G046700.3.p 194 KFAHFTANQAILEATADDPAVHVVDLNVGEGVQWASLMSDLARRHGSRKRFRLTeAFVTADADaGAAAHRTAGRLLSEFAASLNVPFQY 282
                           ******************************************************6566656666788888889999************* PP

                  GRAS 179 nvlvakrledleleeLrvkp...........gEalaVnlvlqlhrlldesvsleserdevL..klvkslsPkvvvvveqe...adh.ns 250
                           + l++++ edl+  +   +            + a   ++v+    + d++ s+  + + +L  ++v+ l+Pk+vv +e+e   + + n 
  Sobic.008G046700.3.p 283 SSLHVRSDEDLHGLAT--SCccncncngsddDSASSSSSVIVSCDTTDQPYSSLTRLQLLLagSVVRILRPKLVVTTEEElfrMGRrNP 369
                           ***8887777733322..22223344556445555556666666777777777776777775569***************888444599 PP

                  GRAS 251 esFlerflealeyysalfdsleaklpres.....eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                           +sF e f eal++y a+++sl + +            + vE+e lg++i+++v + + +    h  l+     +e  GF++ ++s++ +
  Sobic.008G046700.3.p 370 NSFEEFFREALHHYGAVLESLGSCFRDGGgggygACLALVEKEALGPRIQDAVGQYQYQ--YGHGPLAGGACGVELEGFRACEMSSFSV 456
                           9********************999866657777788999***************99988..99************************** PP

                  GRAS 335 kqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                           +q ++l + ++ +g+ v + +g l l+Wk+rpL+svS+W
  Sobic.008G046700.3.p 457 AQGRMLAALFS-RGFGVVHGDGRLALCWKSRPLTSVSVW 494
                           ***********.*************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531.25687476IPR005202Transcription factor GRAS
PfamPF035141.8E-61115494IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
METMSYPYSP LIPFPTQHEQ SSYLLWSPQV LTPLENGNMC DGDADADPSP DQQQQDHELM  60
NMLLQEANVL LLQDELSNGD PSLDGFDQRL GGGQENGNLL LGVQEEFMEE SSLGDLLVAG  120
ARAVESRDAI SASAILSRID AALVSSSDHL ACYFARGLRS RISGECRSTA DDAAAPGNRM  180
PAYRMLQELS PFIKFAHFTA NQAILEATAD DPAVHVVDLN VGEGVQWASL MSDLARRHGS  240
RKRFRLTEAF VTADADAGAA AHRTAGRLLS EFAASLNVPF QYSSLHVRSD EDLHGLATSC  300
CCNCNCNGSD DDSASSSSSV IVSCDTTDQP YSSLTRLQLL LAGSVVRILR PKLVVTTEEE  360
LFRMGRRNPN SFEEFFREAL HHYGAVLESL GSCFRDGGGG GYGACLALVE KEALGPRIQD  420
AVGQYQYQYG HGPLAGGACG VELEGFRACE MSSFSVAQGR MLAALFSRGF GVVHGDGRLA  480
LCWKSRPLTS VSVWSPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-3012149627380Protein SCARECROW
5b3h_A2e-3012149626379Protein SCARECROW
5b3h_D2e-3012149626379Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.008G046700.3.p
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269681e-122KJ726968.1 Zea mays clone pUT3669 GRAS transcription factor (GRAS5) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441872.20.0nodulation-signaling pathway 2 protein
RefseqXP_021301621.10.0nodulation-signaling pathway 2 protein
RefseqXP_021301622.10.0nodulation-signaling pathway 2 protein
TrEMBLA0A1B6PBA00.0A0A1B6PBA0_SORBI; Uncharacterized protein
STRINGSb08g003950.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76843250
Representative plantOGRP8945915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.19e-28RGA-like 2