PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G023401.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 528aa    MW: 56399.2 Da    PI: 6.4258
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G023401.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS409.82.5e-1251565192374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalklfsev 87 
                            +lLl+cAeav++++l  a+++L ++ ela+p g++++R+aayf+eA++arl+ s+ ++y+ lpp +    +      ++aa+++f+ +
  Sobic.008G023401.1.p 156 LTLLLQCAEAVNADNLDDAHRCLLEIAELATPFGTSTHRVAAYFAEAMSARLVTSCLGIYAPLPPGNPVAARlhgRGVAAAAFQVFNGI 244
                           579************************************************************88777666656677888999****** PP

                  GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                           sP++kfsh+taNqaI ea+e+e+rvHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g+    s ++l++tg+rL++fA++lg+pf
  Sobic.008G023401.1.p 245 SPFVKFSHFTANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTGLGA----SMDALQATGKRLSDFADTLGLPF 329
                           **************************************************************....*********************** PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           ef + va++  ++++e+L v ++Ea+aV++ +  h+l+d ++s ++    +L+l+++l Pkvv++veq+++  s+sFl+rf+ea++yys
  Sobic.008G023401.1.p 330 EFCA-VAEKAGNVDPEKLGVTRREAVAVHWLH--HSLYDVTGSDSN----TLWLIQRLAPKVVTMVEQDLSQ-SGSFLARFVEAIHYYS 410
                           ****.7*************************9..999999999999....********************98.899************* PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           alfdsl+a+++++s er++vE++ll+rei+nv+a  g +r+ + + +++Wre+l ++GF++++l   aa+qa+lll +++sdgy++ ee
  Sobic.008G023401.1.p 411 ALFDSLDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFVGSWREKLAQSGFRAASLAGGAAAQASLLLGMFPSDGYTLVEE 499
                           ***************************************************************************************** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                           +g+l lgWkd  L+++SaWr
  Sobic.008G023401.1.p 500 NGALKLGWKDLCLLTASAWR 519
                           *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.831129499IPR005202Transcription factor GRAS
PfamPF035148.6E-123156519IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
AAEVAAAAAP STTAWVDGII RDIIGSSGGA GVSVAQLIHN VREIIHPCNP GLASLLELRL  60
RSLLAPADPA PLHPPLLHAA PHVAALPPAP PPPPPLHSAE KHCPPPPQQD QEPNNPPAPS  120
QSPKAPTAEE TAAAAAKERK EEPRRRQRDE EGLHLLTLLL QCAEAVNADN LDDAHRCLLE  180
IAELATPFGT STHRVAAYFA EAMSARLVTS CLGIYAPLPP GNPVAARLHG RGVAAAAFQV  240
FNGISPFVKF SHFTANQAIQ EAFEREDRVH IIDLDIMQGL QWPGLFHILA SRPGGPPRVR  300
LTGLGASMDA LQATGKRLSD FADTLGLPFE FCAVAEKAGN VDPEKLGVTR REAVAVHWLH  360
HSLYDVTGSD SNTLWLIQRL APKVVTMVEQ DLSQSGSFLA RFVEAIHYYS ALFDSLDASY  420
GEDSPERHVV EQQLLSREIR NVLAVGGPAR TGDVKFVGSW REKLAQSGFR AASLAGGAAA  480
QASLLLGMFP SDGYTLVEEN GALKLGWKDL CLLTASAWRP IHQAPCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A0.01395203380Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.78060.0leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the initial daughter cell before its asymmetric division and remains expressed in the endodermal cell layer after the division. {ECO:0000269|PubMed:17446396}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for quiescent center cells specification and maintenance of surrounding stem cells, and for the asymmetric cell division involved in radial pattern formation in roots. Essential for cell division but not differentiation of the ground tissue. Regulates the radial organization of the shoot axial organs. Restricts SHR movment and sequesters it into the nucleus of the endodermis (By similarity). {ECO:0000250, ECO:0000269|PubMed:17446396}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.008G023401.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0636820.0BT063682.1 Zea mays full-length cDNA clone ZM_BFc0094J16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021301478.10.0protein SCARECROW-like
SwissprotQ2RB590.0SCR1_ORYSJ; Protein SCARECROW 1
TrEMBLA0A1B6PAZ30.0A0A1B6PAZ3_SORBI; Uncharacterized protein (Fragment)
STRINGOS11T0124300-010.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Representative plantOGRP21831437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein