PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G020700.1.p
Common NameSb08g001830, SORBIDRAFT_08g001830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family ZF-HD
Protein Properties Length: 93aa    MW: 9745.74 Da    PI: 7.8354
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G020700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.28.6e-332479359
           ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                           v+Y+eC++NhAas+GghavDGC+Efm+s g+egtaaal CaACgCHR+FHRreve+
  Sobic.008G020700.1.p 24 VVHYRECQRNHAASIGGHAVDGCREFMAS-GAEGTAAALMCAACGCHRSFHRREVET 79
                          799*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-212290IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.4E-312577IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.2E-272677IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.6632776IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MGPQQDRRSM ANGTAARSKE AAKVVHYREC QRNHAASIGG HAVDGCREFM ASGAEGTAAA  60
LMCAACGCHR SFHRREVETA DDRDCSSTTS SG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9760101e-70EU976010.1 Zea mays clone 508548 zinc finger homeodomain protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442725.13e-61hypothetical protein SORBIDRAFT_08g001830
SwissprotB8BIU81e-35MIF1_ORYSI; Mini zinc finger protein 1
SwissprotQ2RB281e-35MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBLC5YQS13e-61C5YQS1_SORBI; Putative uncharacterized protein Sb08g001830
STRINGSb08g001830.11e-60(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-31mini zinc finger 2