PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G223200.2.p
Common NameDof22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 266aa    MW: 27579.6 Da    PI: 6.1323
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G223200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.81e-3750106662
                zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +cprC s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss
  Sobic.007G223200.2.p  50 DPCPRCASRDTKFCYYNNYNTSQPRHFCKGCRRYWTKGGTLRNVPVGGGTRKKPSSS 106
                           68**************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2641100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.24850104IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3151102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MQEVSVEPGR RPAQQPHHQF AGVDLRRPKG YATAPVQEAT PAVKVAEGGD PCPRCASRDT  60
KFCYYNNYNT SQPRHFCKGC RRYWTKGGTL RNVPVGGGTR KKPSSSSYAA AAAAAADADN  120
KPPKKKPASK KRRVEAPVPE PAAAADASGV TDTVAAADSA KTTTTTTTTT TDGASEITTE  180
TEAAVAVAVP VAEEDSESLA HLLLQPGAEE AVSLGLGLSD FPSAAGKAVL DDDSFVWPAA  240
FDLGTCWASA GFADTDPASL FLNLP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.93180.0root| shoot
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in all tissues examined.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence at the MNF1-binding site.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.007G223200.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824150.0KC582415.1 Sorghum bicolor dof22 protein (dof22) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445972.20.0dof zinc finger protein MNB1A
SwissprotP385645e-98MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLE6PBM90.0E6PBM9_SORBI; Dof-type zinc finger protein 22
STRINGSb07g028850.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.11e-28Dof family protein
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]
  2. Yanagisawa S,Izui K
    Molecular cloning of two DNA-binding proteins of maize that are structurally different but interact with the same sequence motif.
    J. Biol. Chem., 1993. 268(21): p. 16028-36
    [PMID:8340424]