PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G184800.1.p
Common NameSb07g025490, SORBIDRAFT_07g025490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family bZIP
Protein Properties Length: 383aa    MW: 40304 Da    PI: 6.5747
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G184800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.56.8e-09194252563
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           k+++r + NR +A rs +RK  +i+eLe+kv+ ++ e +aL+ +l  l+   a l+ e+
  Sobic.007G184800.1.p 194 KKAKRIINNRQSAARSKERKMRYIAELERKVQFMQREATALATQLALLQRDTAGLTVEN 252
                           89**********************************************99999888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576126No hitNo description
SMARTSM003388.9E-15190254IPR004827Basic-leucine zipper domain
PfamPF077161.7E-7192243IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.484192255IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-9194248No hitNo description
SuperFamilySSF579595.98E-10194248No hitNo description
CDDcd147034.73E-22195246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MNKDKTPIAG GGGGNAGGGG GGGGGCAGNG PEMQSSSDAA APSPTPHTEC DISSMPDSPM  60
RKPGHRRALS EIIGLPEDLD LGAPGAGDAP GLSDENEEEL FSMFLDVDKL NSRCGASVSE  120
SSCAMAAGGR GEATETSAAG QGQRHHHRHS MDAASSINAE HLFGTTAMEG ASPAEVKKAM  180
SAAKLAELAL IDPKKAKRII NNRQSAARSK ERKMRYIAEL ERKVQFMQRE ATALATQLAL  240
LQRDTAGLTV ENSELKIRLQ STEQQVHLQD ALNEALKSEL QRLKVATGQM GNQMMMNFAG  300
PPHAFGGGNQ QVFHHPSQAM PPFLAMQQQQ QQHPNQPLHP LQTQQQLQQA ALSLNMKGPA  360
AVAPPGQWQW GGGDAWSESS SS*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in levels in leaf sheath, moderate levels in leaf blade, but not in roots. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.007G184800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0359850.0BT035985.1 Zea mays full-length cDNA clone ZM_BFb0090M08 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444656.10.0transcription factor RF2a
SwissprotQ69IL41e-105RF2A_ORYSJ; Transcription factor RF2a
TrEMBLC5YH980.0C5YH98_SORBI; Uncharacterized protein
STRINGSb07g025490.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.51e-67bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]