PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G160400.1.p
Common NameSb07g023360, SORBIDRAFT_07g023360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family ZF-HD
Protein Properties Length: 312aa    MW: 31798.5 Da    PI: 7.3
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G160400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.42.9e-3275128458
           ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                           +rY+eClkNhA+ +GghavDGCgEfm++ ge+g+++al+CaACgCHRnFHR+e++
  Sobic.007G160400.1.p  75 TRYRECLKNHAVGIGGHAVDGCGEFMAA-GEDGSIDALRCAACGCHRNFHRKESD 128
                           79*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047705.3E-2975127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2376126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.0E-2976126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.85877126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.33E-20234309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-32237310IPR009057Homeodomain-like
TIGRFAMsTIGR015652.5E-25248304IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDFDEHDDGD EEMTPMPVSS SYDAPMQPAG LVAGLGGGGG GGTPKPGDSG GGSFRTPGGV  60
VVGGGVGGGA GGGGTRYREC LKNHAVGIGG HAVDGCGEFM AAGEDGSIDA LRCAACGCHR  120
NFHRKESDSP TGGGGADPAA AAALSPAAIT AYGAAAAHHH HHQFSPYYRT PAGYLLHQHQ  180
QLAAAAAGHM QMQRPLALPS TSHSGRVDEG DDMSGLIGPL VVAPMVGMSL GGSGGGGPSG  240
SGGSGSGKKR FRTKFTQEQK DRMLAFAERL GWRIQKHDEA AVQQFCEEVC VKRHVLKVWM  300
HNNKHTLGKK P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-282493061875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9632770.0EU963277.1 Zea mays clone 260287 ZF-HD protein dimerisation region containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445649.10.0hypothetical protein SORBIDRAFT_07g023360
SwissprotQ6ZB901e-124ZHD2_ORYSJ; Zinc-finger homeodomain protein 2
SwissprotA2YWA61e-124ZHD2_ORYSI; Zinc-finger homeodomain protein 2
TrEMBLC5YMP00.0C5YMP0_SORBI; Putative uncharacterized protein Sb07g023360
STRINGSb07g023360.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-30homeobox protein 22