PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G267900.1.p
Common NameDof21, Sb06g033010, SORBIDRAFT_06g033010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 225aa    MW: 23265.7 Da    PI: 7.7729
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G267900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.59.2e-3651107258
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58 
                           ++++l+cprC stntkfCyynnys++qPr+fC+aCrryWt+GG+lr+vPvGg++r++
  Sobic.006G267900.1.p  51 QQQQLECPRCRSTNTKFCYYNNYSTAQPRHFCRACRRYWTHGGTLRDVPVGGASRRS 107
                           6899***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.6E-3353107IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-215599IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.89455109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MAPAASILSA TAAAAGASKR PADSDAELSL DSSALQQQGD EAVRKGRQTR QQQQLECPRC  60
RSTNTKFCYY NNYSTAQPRH FCRACRRYWT HGGTLRDVPV GGASRRSSGG GGKRRRVSAE  120
PSSAASSSPP PLPAASLADA CLPDLTSAFP FLSDGSFFPQ FDVGSGVALA PAAFSSSWQS  180
VVPDFYDGLA PWDDGAAAGT AAGGFVGAWG DIAGLDLSWT PPGN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112116KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00593DAPTransfer from AT5G66940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.006G267900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824140.0KC582414.1 Sorghum bicolor dof21 protein (dof21) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448779.11e-159dof zinc finger protein DOF5.8
TrEMBLC5YAJ61e-158C5YAJ6_SORBI; Dof-type zinc finger protein 21
STRINGSb06g033010.11e-159(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140472427
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.14e-28Dof family protein
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]