PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G201600.1.p
Common NameSb06g027340, SORBIDRAFT_06g027340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LFY
Protein Properties Length: 392aa    MW: 42338.1 Da    PI: 9.4351
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G201600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY536.69.1e-16413771386
               FLO_LFY   1 mdpea.fsas.lfkwd..praaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdee 85 
                           mdp++ fsa+  f+wd  p a aa+pp    + a +++++l  +a     + rele+l+ +yGvr +tva+i+elGft+stL++m+++e
  Sobic.006G201600.1.p   1 MDPNDaFSAAhPFRWDlgPPAHAAPPPPPPPQPAPAPAPQLPPHAPLVYAAPRELEDLVAGYGVRPSTVARISELGFTASTLLGMTERE 89 
                           777654876659****884444444444444455555555567777778889************************************* PP

               FLO_LFY  86 lddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelv 174
                           ldd+m++l+ +fr+d+l+Ger+G++aa+raer r+++      r      ++ ++lda+sqe+ls+e++     aa+sgg+ ++ +  +
  Sobic.006G201600.1.p  90 LDDMMAALAGLFRWDVLLGERFGLRAALRAERGRVMSLG---GRF-----HTGSTLDAASQEVLSDERD-----AAASGGTVMAGK--K 163
                           ************************************955...555.....36789***********977.....556655552222..2 PP

               FLO_LFY 175 aaeekkseeekkkaskkkqkrkkkkelkseededee...eeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCr 260
                           + + k   ++k k++++k++ +  + l  e+d de+    +e+++++ +g++g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr
  Sobic.006G201600.1.p 164 KGN-KGVGSRKGKKARRKKELRPLDVLGDENDGDEDgggGSESTESSAGGSGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCR 251
                           222.12222222222222222333322222333332111455556666889999*********************************** PP

               FLO_LFY 261 efLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaa 349
                            fLlqvq+iak  G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k+rgenvGawrqacy+plv+iaa
  Sobic.006G201600.1.p 252 VFLLQVQSIAKLGGHKSPTKVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKARGENVGAWRQACYAPLVEIAA 340
                           ***************************************************************************************** PP

               FLO_LFY 350 rqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                           r+g+didavf+ahprL+iWYvPt+LrqLCh++r +++
  Sobic.006G201600.1.p 341 RHGFDIDAVFAAHPRLAIWYVPTRLRQLCHQARGNHA 377
                           *********************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.4E-1921377IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MDPNDAFSAA HPFRWDLGPP AHAAPPPPPP PQPAPAPAPQ LPPHAPLVYA APRELEDLVA  60
GYGVRPSTVA RISELGFTAS TLLGMTEREL DDMMAALAGL FRWDVLLGER FGLRAALRAE  120
RGRVMSLGGR FHTGSTLDAA SQEVLSDERD AAASGGTVMA GKKKGNKGVG SRKGKKARRK  180
KELRPLDVLG DENDGDEDGG GGSESTESSA GGSGGGERQR EHPFVVTEPG EVARAKKNGL  240
DYLFHLYEQC RVFLLQVQSI AKLGGHKSPT KVTNQVFRYA KKCGASYINK PKMRHYVHCY  300
ALHCLDEEAS NALRRAYKAR GENVGAWRQA CYAPLVEIAA RHGFDIDAVF AAHPRLAIWY  360
VPTRLRQLCH QARGNHAHVH AAAGFPPPPM F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1002153752162PROTEIN LEAFY
2vy2_A1e-1002153752162PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161180KKKGNKGVGSRKGKKARRKK
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In the vegetative phase, expressed in shoot meristems and leaf primordia. In the reproductive phase, present in the meristems of primary and secondary branches at primordial and elongating stages, but later transiently down-regulated from the meristems, when the meristem identity change from inflorescence to spikelet. Subsequent expression recovery when spikelets are differentiated, with an accumulation in floral meristems and in primordia of all floral organs, including lodicules, stamens, carpels and ovules. {ECO:0000269|PubMed:21910771}.
UniprotTISSUE SPECIFICITY: In very young panicle but not in mature florets, mature leaves, roots or apical meristems. {ECO:0000269|PubMed:9482818}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.006G201600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1798820.0AY179882.1 Zea mays cultivar A632 floricaula/leafy-like 1 (fl1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021317930.10.0probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLC5YF410.0C5YF41_SORBI; Uncharacterized protein
STRINGSb06g027340.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Representative plantOGRP70181619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.17e-99floral meristem identity control protein LEAFY (LFY)