PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G188900.2.p
Common NameSb06g026240, SORBIDRAFT_06g026240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 603aa    MW: 63185.1 Da    PI: 6.2015
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G188900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS46.28e-152823842109
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL e+A a+++g++ +a + La l+  a+++gd+ qRl+a+++ AL++r+ r     +++ p+++ +e  s ++ a  +l++++sP+
  Sobic.006G188900.2.p 282 RQLLSEAAVAIADGHHDAAATHLAALKRAANQHGDAEQRLIAMMVDALSSRIGR-----AASAPAQHLAELCSGDQRAGSQLLQDISPC 365
                           689***************************************************.....5556666666666778888889******** PP

                  GRAS  91 lkfshltaNqaIleavege 109
                           ++++  +a  aI+ea++++
  Sobic.006G188900.2.p 366 FRVALHAASVAIVEAAQTA 384
                           ***************9876 PP

2GRAS182.92.3e-56383602155374
                  GRAS 155 keeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvve 243
                           + +l +++e L+k+Ae+ gv+ +fnv v+ r +dl+ ++L ++pgEa+aVnl+++l +++desvs +++rde+L+ v+ l P+vv++ve
  Sobic.006G188900.2.p 383 TASLTTIAEPLKKLAERAGVEYRFNV-VSCRAADLDASRLCCEPGEAVAVNLAFALSHVPDESVSPANPRDELLRRVRALGPQVVTLVE 470
                           56789999*****************9.7999********************************************************** PP

                  GRAS 244 qeadhnsesFlerflealeyysalfdsleaklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331
                           qe+++n++++++rf++a+ +y a+++sl+a+l+re+  e++   ++ l +++ n+v   g +r er+e ++kWr+r+++aGF+pv+l++
  Sobic.006G188900.2.p 471 QELNTNTAPLAARFTDACAHYGAILESLDATLGRETsAEKARAAEAALWKKAANAVGRDGPDRLERCEVFGKWRARFGMAGFRPVSLGS 559
                           *********************************98866677777777****************************************** PP

                  GRAS 332 kaakq.aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            +a+q + + +   +   + v+ e+g l l+Wk+r ++++SaWr
  Sobic.006G188900.2.p 560 GIAEQlVGARVGLLP-PAFAVKAENGVLRLCWKGRVVTVASAWR 602
                           999993467777777.66*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098522.648172582IPR005202Transcription factor GRAS
PfamPF035147.9E-54383602IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYAYGVGS AMQMQLQQRA DAAAGGGVLK RSLGELERWQ HHQQQQVAAQ  60
QELYLRTVRQ RTAAAVDIAA LLGGTPARPL VLPGSSFGGG LASPSSTLSS LTTASRAAVP  120
LMQPQLQRQV PLMTSSPQTQ AFGLSRAPPL PQPASSSELF ILQELEKQLL DDDDDDDEPV  180
AAMSGTGSAV TNSEWEETIQ QFSSIAAAAM SGTGSAVTNS EWEETIQQLS SIAAAPSPGL  240
PAAATPNNNI NNNNNVGMTR SPSNSSSSTA SSSASCSPPA SRQLLSEAAV AIADGHHDAA  300
ATHLAALKRA ANQHGDAEQR LIAMMVDALS SRIGRAASAP AQHLAELCSG DQRAGSQLLQ  360
DISPCFRVAL HAASVAIVEA AQTASLTTIA EPLKKLAERA GVEYRFNVVS CRAADLDASR  420
LCCEPGEAVA VNLAFALSHV PDESVSPANP RDELLRRVRA LGPQVVTLVE QELNTNTAPL  480
AARFTDACAH YGAILESLDA TLGRETSAEK ARAAEAALWK KAANAVGRDG PDRLERCEVF  540
GKWRARFGMA GFRPVSLGSG IAEQLVGARV GLLPPAFAVK AENGVLRLCW KGRVVTVASA  600
WR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-2530060222375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.006G188900.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0403810.0BT040381.1 Zea mays full-length cDNA clone ZM_BFc0087O19 mRNA, complete cds.
GenBankBT0840740.0BT084074.1 Zea mays full-length cDNA clone ZM_BFb0071H03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448375.10.0scarecrow-like protein 8 isoform X1
TrEMBLA0A1Z5RFQ90.0A0A1Z5RFQ9_SORBI; Uncharacterized protein
STRINGSb06g026240.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-57SCARECROW-like 8