PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G188900.1.p
Common NameSb06g026240, SORBIDRAFT_06g026240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 653aa    MW: 68654.2 Da    PI: 6.453
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G188900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.19.3e-912826522374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL e+A a+++g++ +a + La l+  a+++gd+ qRl+a+++ AL++r+ r     +++ p+++ +e  s ++ a  +l++++sP+
  Sobic.006G188900.1.p 282 RQLLSEAAVAIADGHHDAAATHLAALKRAANQHGDAEQRLIAMMVDALSSRIGR-----AASAPAQHLAELCSGDQRAGSQLLQDISPC 365
                           689***************************************************.....5556666666666778888889******** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvp 175
                           ++++  +a  aI+eav  ++++H++Dfd+s  +Q +aL+q La+R+ +  sl++T+v +p+s     ++ +l +++e L+k+Ae+ gv+
  Sobic.006G188900.1.p 366 FRVALHAASVAIVEAVGDHRAIHVVDFDVSL-AQHAALIQYLAERRVQGRSLKVTAVTDPSSPfsqaQTASLTTIAEPLKKLAERAGVE 453
                           *****************************98.7**************************99888999999******************* PP

                  GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                            +fnv v+ r +dl+ ++L ++pgEa+aVnl+++l +++desvs +++rde+L+ v+ l P+vv++veqe+++n++++++rf++a+ +y
  Sobic.006G188900.1.p 454 YRFNV-VSCRAADLDASRLCCEPGEAVAVNLAFALSHVPDESVSPANPRDELLRRVRALGPQVVTLVEQELNTNTAPLAARFTDACAHY 541
                           ****9.7999******************************************************************************* PP

                  GRAS 265 salfdsleaklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq.aklllrkvksdgyrv 351
                            a+++sl+a+l+re+  e++   ++ l +++ n+v   g +r er+e ++kWr+r+++aGF+pv+l++ +a+q + + +   +   + v
  Sobic.006G188900.1.p 542 GAILESLDATLGRETsAEKARAAEAALWKKAANAVGRDGPDRLERCEVFGKWRARFGMAGFRPVSLGSGIAEQlVGARVGLLP-PAFAV 629
                           ************98866677777777******************************************999993467777777.66*** PP

                  GRAS 352 eeesgslvlgWkdrpLvsvSaWr 374
                           + e+g l l+Wk+r ++++SaWr
  Sobic.006G188900.1.p 630 KAENGVLRLCWKGRVVTVASAWR 652
                           **********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.166255632IPR005202Transcription factor GRAS
PfamPF035143.2E-88282652IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYAYGVGS AMQMQLQQRA DAAAGGGVLK RSLGELERWQ HHQQQQVAAQ  60
QELYLRTVRQ RTAAAVDIAA LLGGTPARPL VLPGSSFGGG LASPSSTLSS LTTASRAAVP  120
LMQPQLQRQV PLMTSSPQTQ AFGLSRAPPL PQPASSSELF ILQELEKQLL DDDDDDDEPV  180
AAMSGTGSAV TNSEWEETIQ QFSSIAAAAM SGTGSAVTNS EWEETIQQLS SIAAAPSPGL  240
PAAATPNNNI NNNNNVGMTR SPSNSSSSTA SSSASCSPPA SRQLLSEAAV AIADGHHDAA  300
ATHLAALKRA ANQHGDAEQR LIAMMVDALS SRIGRAASAP AQHLAELCSG DQRAGSQLLQ  360
DISPCFRVAL HAASVAIVEA VGDHRAIHVV DFDVSLAQHA ALIQYLAERR VQGRSLKVTA  420
VTDPSSPFSQ AQTASLTTIA EPLKKLAERA GVEYRFNVVS CRAADLDASR LCCEPGEAVA  480
VNLAFALSHV PDESVSPANP RDELLRRVRA LGPQVVTLVE QELNTNTAPL AARFTDACAH  540
YGAILESLDA TLGRETSAEK ARAAEAALWK KAANAVGRDG PDRLERCEVF GKWRARFGMA  600
GFRPVSLGSG IAEQLVGARV GLLPPAFAVK AENGVLRLCW KGRVVTVASA WR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3830065222375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0840740.0BT084074.1 Zea mays full-length cDNA clone ZM_BFb0071H03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448375.10.0hypothetical protein SORBIDRAFT_06g026240
TrEMBLC5YEH20.0C5YEH2_SORBI; Putative uncharacterized protein Sb06g026240
STRINGSb06g026240.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7599918
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-74SCARECROW-like 8