PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G182300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 389aa    MW: 38945.9 Da    PI: 8.5665
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G182300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.5e-3989150263
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                           kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Sobic.006G182300.1.p  89 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 150
                           7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3185147IPR003851Zinc finger, Dof-type
PfamPF027012.6E-3391147IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05993147IPR003851Zinc finger, Dof-type
PROSITE patternPS01361095131IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MVMCSRSSSS SSTETHNPTR AQAAKGLGLV KPMEEMLMAA NAGAANPSQG SNNPNPPAPA  60
PGGALRGGGA PAAPLAGAGS TERRARPQKE KALNCPRCNS TNTKFCYYNN YSLQQPRYFC  120
KTCRRYWTEG GSLRNVPVGG GSRKNKRSSS SASASASTSA SVTSSSMASA EGAAASKNPK  180
LAHEGAHDLN LAFPHHGGLH APEFAAFPSL ESSNVCNPGG GMTSNGRGGG AGPAVGALSA  240
MELLRSSGCY MPLQMPMQMQ GDYTAAEFAL GDFRTPPPPP SQSVLGFSLD AHGPGSGAAA  300
AGYGSSAGLQ GVTENAGRLL FPFEDLKPPV SSGGGGVAGG ATGGAGDGNS NHNQFDHNKE  360
QDGGGGPGAG HDTPGFWSGM IGGSGASW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.202873e-84callus
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at low level in germinating seeds 3 to 5 days after imbibition. {ECO:0000269|PubMed:11470159}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.006G182300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824130.0KC582413.1 Sorghum bicolor dof20 protein (dof20) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448355.20.0dof zinc finger protein DOF4.6 isoform X1
SwissprotQ9SXG81e-124DOF1_ORYSJ; Dof zinc finger protein 1
TrEMBLA0A1B6PMP30.0A0A1B6PMP3_SORBI; Uncharacterized protein
STRINGSb06g025680.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-43Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]