PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G169200.1.p
Common NameSb06g024480, SORBIDRAFT_06g024480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 234aa    MW: 25756.4 Da    PI: 8.9183
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G169200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.4e-1978132256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  Sobic.006G169200.1.p  78 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTK 132
                           788899***********************************************98 PP

2HD-ZIP_I/II130.46.9e-4278167191
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr 
  Sobic.006G169200.1.p  78 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKEVQELR- 165
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 el 91 
                           +l
  Sobic.006G169200.1.p 166 AL 167
                           55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.1E-1970135IPR009057Homeodomain-like
PROSITE profilePS5007117.31374134IPR001356Homeobox domain
SMARTSM003897.4E-1876138IPR001356Homeobox domain
CDDcd000864.07E-1578135No hitNo description
Gene3DG3DSA:1.10.10.607.3E-1978132IPR009057Homeodomain-like
PfamPF000466.5E-1778132IPR001356Homeobox domain
PRINTSPR000314.0E-6105114IPR000047Helix-turn-helix motif
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PRINTSPR000314.0E-6114130IPR000047Helix-turn-helix motif
SMARTSM003402.3E-25134177IPR003106Leucine zipper, homeobox-associated
PfamPF021831.7E-11134168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MMERVEDLGL SLSLSSSLAS PRTHHVATML LRAPPEKRFL EMPLLLPAKR SELATGEEGL  60
RGGGSDEEDG GCGIDGSRKK LRLSKDQSAV LEDSFREHPT LNPRQKAALA QQLGLRPRQV  120
EVWFQNRRAR TKLKQTEVDC EYLKRCCETL TEENRRLHKE VQELRALKLV SPHLYMHMPP  180
PTTLTMCPSC ERVSSSNASN ANSAAADRKA GAGVADGGAI VCHRPIAVRP QQS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17682SRKKLRL
2126134RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.115950.0shoot
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.006G169200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9749800.0EU974980.1 Zea mays clone 462177 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
GenBankKJ7283620.0KJ728362.1 Zea mays clone pUT6644 HB transcription factor (HB53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448285.11e-171homeobox-leucine zipper protein HOX17
SwissprotQ01I231e-114HOX17_ORYSI; Homeobox-leucine zipper protein HOX17
TrEMBLC5YDG31e-170C5YDG3_SORBI; Uncharacterized protein
STRINGSb06g024480.11e-170(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.11e-65homeobox-leucine zipper protein 4