PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G166300.2.p
Common NameSb06g024220, SORBIDRAFT_06g024220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family WRKY
Protein Properties Length: 253aa    MW: 27302.9 Da    PI: 8.1801
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G166300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.5e-32172230159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+
  Sobic.006G166300.2.p 172 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHTHS 230
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-33157230IPR003657WRKY domain
SuperFamilySSF1182901.57E-28164230IPR003657WRKY domain
PROSITE profilePS5081128.92167229IPR003657WRKY domain
SMARTSM007747.7E-38172231IPR003657WRKY domain
PfamPF031063.6E-25173229IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MHACMEGSSQ LLETCLPASS LYALSPHHPL LAPLPNQHKL LQMPLVQEQA AANNHGVMLY  60
SDHHHHGGGL LYPLLLPGIP FCPFSAAADA ATCDKTTTTG GFAALDAGEA GTSVAKAAGE  120
IASTTTTCNG PSSCNWWKGP AAAGEKGGRM KVRRKMREPR FCFQTRSDVD VLDDGYKWRK  180
YGQKVVKNSL HPRSYYRCTH SNCRVKKRVE RLSEDCRMVI TTYEGRHTHS PCSDDADAAA  240
GDHTGSCAFT SL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A9e-25163229874Probable WRKY transcription factor 4
1wj2_A9e-25163229874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147155GRMKVRRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9728050.0EU972805.1 Zea mays clone 388369 WRKY36 - superfamily of TFs having WRKY and zinc finger domains mRNA, complete cds.
GenBankBT0679820.0BT067982.1 Zea mays full-length cDNA clone ZM_BFb0009G22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448267.10.0hypothetical protein SORBIDRAFT_06g024220
TrEMBLC5YD390.0C5YD39_SORBI; Putative uncharacterized protein Sb06g024220
STRINGSb06g024220.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-51WRKY family protein