PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G162800.1.p
Common NameSb06g023940, SORBIDRAFT_06g023940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GATA
Protein Properties Length: 452aa    MW: 47435.3 Da    PI: 8.0205
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G162800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA603.1e-19371405135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Sobic.006G162800.1.p 371 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 405
                           *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.8E-14362426No hitNo description
SMARTSM004014.7E-18365419IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.044365401IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.1E-15369403IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.13E-15370427No hitNo description
PROSITE patternPS003440371396IPR000679Zinc finger, GATA-type
PfamPF003203.2E-17371405IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MLHQTLIPSS FSPSVSASSS SPFLHAPNAA TTTTTTTAPG GSCTPPAFPR GSSAMPSYAH  60
HHSSSPLDDG KMDVLKCGNS VPPEDDAAAA GALVEKDGFS VEDLLDLEEF GEPDKDGAEH  120
EDDAPALAAA VEEQPKAESQ PLSVVTYELP PPPPPPELVD LPSHDVEELE WVSRIMDDSL  180
SELPPQPQPP MAAVVASLAG RPPLAQQRRP PLAHDGAYRA VAPPSHGPLR TPTICALSTE  240
AMIPVKAKRS KRSRGPGWSR SGASFLSDSA SSSSTTTTSS CSSSGSFSPF LRLDSPPFGG  300
FDLGLGEGLF SHLLPLPLPR PPSKKSKHGA KGSKHKPKKR GRKPKHLPPH HPSAGGGAAA  360
SQQPGPSDRR CSHCGVQKTP QWRAGPEGAK TLCNACGVRY KSGRLLPEYR PACSPTFESS  420
IHSNSHRKVL EMRRKKEGDM VANAAPAVAS F*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.79890.0callus| ovary
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9693520.0EU969352.1 Zea mays clone 329022 GATA zinc finger family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446866.10.0hypothetical protein SORBIDRAFT_06g023940
TrEMBLC5YD070.0C5YD07_SORBI; Putative uncharacterized protein Sb06g023940
STRINGSb06g023940.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.28e-40GATA transcription factor 5