PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G093800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 701aa    MW: 78438.2 Da    PI: 6.054
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G093800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.95e-913196922373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            +lL++cA+av++++l+ a +lL++++++as +gd++qRla +f ++L+ rl++++s+++k l +++ s    +e  +a++l+  ++ +
  Sobic.006G093800.1.p 319 HTLLIHCAQAVDTSNLKIAVELLKQIKQHASATGDATQRLALCFSKGLEVRLVGTGSQVSKLLMAERPS---AVEFRKAYSLYIAACSF 404
                           679**********************************************************99888887...89999************ PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfd.isqGlQWpaLlqaLasRp..egppslRiTgvgspesg..skeeleetgerLakfAeelgv 174
                            k++h+   + I++ + g++r+Hi+D+d +++ +QW+ L++ La+R+  ++pp+++iT+++ +++    ++ +ee ++rL+  A+e+g+
  Sobic.006G093800.1.p 405 NKVAHIFSTRSIMQTMVGKNRLHIVDYDdVNYEFQWADLIRLLANRNreGDPPEMKITAISGSQPRscPSQWIEEQEHRLNMCASEFGI 493
                           ***************************559**************9988789**********988888899******************* PP

                  GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                           pf f+v ++ + e++++e+L+++++E+l+Vn +++  +l+ e++   +  +rd+vL+ +++++P++++ +  +++h ++sFl rf eal
  Sobic.006G093800.1.p 494 PFTFRV-MTMKREEVSIENLNIDEDEVLVVNDIFNFSSLVGETAFFGDlsPRDTVLNNIRKMKPNIFIQSVLNCSH-GTSFLSRFREAL 580
                           *****9.68889*******************************98887779*************************.678********* PP

                  GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                            +ys++fd+l+a +pr+se+r ++E+ +lgr++ n++ac g + + r e++++W+ r ++aG++++pl+ +++k+ k +++k++ + + 
  Sobic.006G093800.1.p 581 FCYSTMFDMLDAIVPRDSEQRLVLEQGMLGRWALNAIACDGVDLIDRPEKYRRWEVRNRRAGLRQLPLEPDIVKELKDMVKKHHHKNFL 669
                           ************************************************************************************999** PP

                  GRAS 351 veeesgslvlgWkdrpLvsvSaW 373
                           + e++++l++gWk+r L++ S W
  Sobic.006G093800.1.p 670 LSEDDQWLLQGWKGRILFAHSTW 692
                           *********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.552292673IPR005202Transcription factor GRAS
PfamPF035141.7E-88319692IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MEPSAPSPSV FHNGEGPLSP DNMVHSYISH MLLEENIDDQ ILCQYYDHPS LLQMQQDLAH  60
ILSSPSSSAK NSTINNGNSE GTESLLHGSS GDPISVSLGF DMGADVVGLL QMQQALAHIL  120
SPPSSSTKNS SINKGNSEGT EGLLHGSSGD PTRVSLGFDK GADVAGAFLK GMEEGRKFLP  180
SDNKGADVVG AFFKGMQEGR QFLPRGNNLL KDDHMLQNSR ESSDQRGFKK SCNRCEHLEE  240
VGRCNKCEHL EEVGRISKGM MMMEAPEEIG MQMFDDMSLC GYETFIRDME ILRIGMNNKV  300
VKNNRKGCSK VARDVVDLHT LLIHCAQAVD TSNLKIAVEL LKQIKQHASA TGDATQRLAL  360
CFSKGLEVRL VGTGSQVSKL LMAERPSAVE FRKAYSLYIA ACSFNKVAHI FSTRSIMQTM  420
VGKNRLHIVD YDDVNYEFQW ADLIRLLANR NREGDPPEMK ITAISGSQPR SCPSQWIEEQ  480
EHRLNMCASE FGIPFTFRVM TMKREEVSIE NLNIDEDEVL VVNDIFNFSS LVGETAFFGD  540
LSPRDTVLNN IRKMKPNIFI QSVLNCSHGT SFLSRFREAL FCYSTMFDML DAIVPRDSEQ  600
RLVLEQGMLG RWALNAIACD GVDLIDRPEK YRRWEVRNRR AGLRQLPLEP DIVKELKDMV  660
KKHHHKNFLL SEDDQWLLQG WKGRILFAHS TWVADEASSE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-283226928374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002447912.10.0hypothetical protein SORBIDRAFT_06g017860
TrEMBLC5Y9800.0C5Y980_SORBI; Putative uncharacterized protein Sb06g017860
STRINGSb06g017860.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-103SCARECROW-like 14