PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G093700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 635aa    MW: 69690.8 Da    PI: 5.8113
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G093700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.21.2e-922456262374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            + L++cA+av+++d + a+ lL+r++ ++sp+gd+++Rla+y++eAL+ rl++++s  y+  ++ +++ ++   +l+a+++f   + +
  Sobic.006G093700.1.p 245 HSMLIRCADAVANNDRRTASDLLQRIRRHSSPSGDATKRLAHYLAEALEVRLNGTGSLQYRPSSVMAKNASSAGVQLKAQQFFMASCCF 333
                           678***************************************************9999999999999999999**************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                           l +  l  N++I++a++g +++Hi+ +++ +GlQW++Ll+ La R++gpp++R+Tg++ p++g   ++ +ee g+rL+  A++lgvpf+
  Sobic.006G093700.1.p 334 LPVNILFSNKTIYNAAAGRKKLHIVHYGLDHGLQWATLLRWLARREGGPPEVRLTGIDVPQPGfrPARLIEEAGRRLTTCARQLGVPFR 422
                           **************************************************************9999999******************** PP

                  GRAS 178 fnvlvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsles.......erdevLklvkslsPkvvvvveqeadhnsesFlerfl 258
                           f+  +a r e+++  +L ++  +E+l+V++ ++  +l de +  ++       ++ +vL ++++++P v+v++  +a+++++ F++rf 
  Sobic.006G093700.1.p 423 FRG-IAARSEAVRAGDLGIDDpDEVLVVSSLFHFRTLTDEGTVAADggeagadPIGAVLGAIREMKPSVFVHAVLNASYSTAFFATRFR 510
                           ***.799************998**********999999665555445555556899********************************* PP

                  GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                           eal+ ++alfd++++ lpr++  r   Er +l+r++vnv+acega+r++  +++++W++r ++aG++++pl+ ++++  k  +++ + +
  Sobic.006G093700.1.p 511 EALYNFTALFDMMDTILPRDNGRRLLFERDVLARSAVNVIACEGADRVQHPRSYKQWQARSRRAGLRQLPLDCDIVQMLKDKVKRGYHE 599
                           ***************************************************************************************99 PP

                  GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                            + + e++++l++ Wk+r L+++S W+
  Sobic.006G093700.1.p 600 NFVITEDQQWLLQAWKGRVLYAISTWT 626
                           9*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.779218606IPR005202Transcription factor GRAS
PfamPF035144.3E-90245626IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MEPTAALPRS FSNHLCPTLH LDGSQDDNVL PFIARMLMED DAVDEFLYQQ YPDHNPALLQ  60
TQQLFAQVLF DTSSTSALAA VQAGAQGNDL QDPPSLNSTA MGAVEPANTL SPAEGSNCFK  120
DAVSMAFLRG MEEANKFLPG AGGGYTADFR GRKKRLDVDG DDEQVEGRSS KQMAADGDEE  180
SEEAAVREML DKLMLNGDDE PILADDMQEL RAAMDMAKTP PPPGRPAGTR ADQVQQQQAV  240
DVDLHSMLIR CADAVANNDR RTASDLLQRI RRHSSPSGDA TKRLAHYLAE ALEVRLNGTG  300
SLQYRPSSVM AKNASSAGVQ LKAQQFFMAS CCFLPVNILF SNKTIYNAAA GRKKLHIVHY  360
GLDHGLQWAT LLRWLARREG GPPEVRLTGI DVPQPGFRPA RLIEEAGRRL TTCARQLGVP  420
FRFRGIAARS EAVRAGDLGI DDPDEVLVVS SLFHFRTLTD EGTVAADGGE AGADPIGAVL  480
GAIREMKPSV FVHAVLNASY STAFFATRFR EALYNFTALF DMMDTILPRD NGRRLLFERD  540
VLARSAVNVI ACEGADRVQH PRSYKQWQAR SRRAGLRQLP LDCDIVQMLK DKVKRGYHEN  600
FVITEDQQWL LQAWKGRVLY AISTWTAGNE LAGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-302486258374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978027.10.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A096Q8260.0A0A096Q826_MAIZE; Uncharacterized protein
STRINGGRMZM2G028608_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1983022
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-118SCARECROW-like 14