PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G231000.1.p
Common NameSb05g027830, SORBIDRAFT_05g027830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 681aa    MW: 75925.6 Da    PI: 6.5105
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G231000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS309.67.1e-952976672373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                             lL++cAeav+++d + +  lL r+++++sp+gd +qRla++f+++L+arl++++s++y++l ++++s    +  l++++l+  ++ i
  Sobic.005G231000.1.p 297 HALLIRCAEAVATNDRQGVADLLLRIRHHSSPTGDGTQRLAHCFAQGLEARLMGTGSQMYHSLVAKSAS---ATVILKVYRLYMAACSI 382
                           579************************************************************999998...899************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                           l + + ++N++ +eav+g +++H++ ++++ G+QWp Ll+ L+ R++gpp++R+Tg+++p +g    + +eetg+rL++ A++++vpf+
  Sobic.005G231000.1.p 383 LPLRFPLTNKTTYEAVAGRKKLHVVHYGLGPGFQWPDLLRMLSHREGGPPEVRLTGIDNPLPGfhPGQIIEETGRRLSDCARQFRVPFK 471
                           ************************************************************9999999********************** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           f++ +a + +d++ e+L+++p+E+l+V ++++  +l+desv ++   +rd+vLk +k+++Pkv+++   + +++++ F+ rf eal+ +
  Sobic.005G231000.1.p 472 FRA-IAAKSDDVRAEDLDIDPEEVLVVISHFHFRTLMDESVIIDRpnPRDTVLKNIKKMRPKVFIHGILNGSYSGAFFVSRFREALNNF 559
                           ***.7999********************************98877669***************************************** PP

                  GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrvee 353
                           +alfd +++++p+e+++r  vE+e l+r ++n++aceg +r+er  ++++W+ r e+aG++++pl+ +++   k  ++k   +   ++e
  Sobic.005G231000.1.p 560 AALFDLMDTTVPQENQNRLLVEQE-LARCAMNIIACEGVDRVERPHSYKQWHVRCERAGLRQLPLDPDIVRASKDKVNKECRKYIVINE 647
                           ************************.9***************************************************99998878999* PP

                  GRAS 354 esgslvlgWkdrpLvsvSaW 373
                           ++g+l+ gWk+r L ++S W
  Sobic.005G231000.1.p 648 DHGWLLKGWKGRVLAAISTW 667
                           ******************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.321270648IPR005202Transcription factor GRAS
PfamPF035142.4E-92297667IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MGIPPELEFS EKRPQVVDFT EPVPPSPSTY LLDLLQAPQV DNGKDDQSYI SHMLLEEDTI  60
GNLLYQYPNH PAALLTGTAE QPFAQILSAA DATSDALTIW PCNSIKNTSL QLSVATPDEY  120
YSYCDMTTSE KLPGDMDSMH VRQDASSLLM NSMHEALAME PNRLLSAAKS SSCCMDVISM  180
AFFKGMEEAN KLLPLQDSET TLARGRGWKK RLQAGKGDDA NVVAMCRSSK QKVAQMTQPD  240
SEEEAAAREM LDRLMLNDNA SHAADVQQEL IIGSMELEKP RGRRHGASAS HTAVDLHALL  300
IRCAEAVATN DRQGVADLLL RIRHHSSPTG DGTQRLAHCF AQGLEARLMG TGSQMYHSLV  360
AKSASATVIL KVYRLYMAAC SILPLRFPLT NKTTYEAVAG RKKLHVVHYG LGPGFQWPDL  420
LRMLSHREGG PPEVRLTGID NPLPGFHPGQ IIEETGRRLS DCARQFRVPF KFRAIAAKSD  480
DVRAEDLDID PEEVLVVISH FHFRTLMDES VIIDRPNPRD TVLKNIKKMR PKVFIHGILN  540
GSYSGAFFVS RFREALNNFA ALFDLMDTTV PQENQNRLLV EQELARCAMN IIACEGVDRV  600
ERPHSYKQWH VRCERAGLRQ LPLDPDIVRA SKDKVNKECR KYIVINEDHG WLLKGWKGRV  660
LAAISTWMAE DDRSDLGNDQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-363006678374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450077.10.0hypothetical protein SORBIDRAFT_05g027830
SwissprotO809331e-129SCL9_ARATH; Scarecrow-like protein 9
TrEMBLC5Y1T10.0C5Y1T1_SORBI; Putative uncharacterized protein Sb05g027830
STRINGSb05g027830.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1981522
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-130GRAS family protein