PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G230900.1.p
Common NameSb05g027820, SORBIDRAFT_05g027820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 635aa    MW: 70914.7 Da    PI: 5.3669
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G230900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3321.1e-1012586312374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            +lL++cAea+s++d  +a  lL+r++ ++sp+gd++qRla++f+++L+arla+++s++y +l ++++s   ++ +l+ ++lf + + +
  Sobic.005G230900.1.p 258 HTLLIRCAEAMSNNDWCAAAGLLERIKYHSSPTGDSTQRLAHCFAKGLEARLAGMGSQTYLSLVAKRAS---MVVVLKTYQLFMDSCCF 343
                           579*********************************************************999999998...9**************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                           l ++ l  N++I++av+g +++Hi+D+++++G+QWp Ll+ L+ R++gpp++R Tg+++p++g   +  +eetg+rL+  A ++gvpf+
  Sobic.005G230900.1.p 344 LPVQLLFSNKTIYKAVAGRKKLHIVDYGLGHGIQWPDLLRWLSRREGGPPEVRFTGIDKPQPGfrPAWPVEETGRRLNACACQFGVPFQ 432
                           ***************************************************************99999********************* PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           f+ ++ k+  ++ +e+L+++p+E+l+Vn++++l++l+des  +e   +rd vL ++ +++P v+v++  + +h+s+ F++rf +al+ y
  Sobic.005G230900.1.p 433 FRGVTKKKPGAIAVEDLDIDPDEVLVVNSMFHLETLMDESIVVERpnPRDVVLGTISKMRPSVFVHAIANGSHSSAFFMARFRDALQRY 521
                           ***9999*********************************88776669***************************************** PP

                  GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrvee 353
                           salfd++++ +pr++++r+ vE+ +++r++++++aceg er+ r +++++W++r ++aG++++pl+ ++++  k  ++k + + + + e
  Sobic.005G230900.1.p 522 SALFDMMDNIAPRDDDKRVLVEQDIFARSATSIIACEGVERVVRPQNYKQWQARNQRAGLRQLPLDPEIVEALKDKVKKEYHKCFVISE 610
                           *********************************************************************************999***** PP

                  GRAS 354 esgslvlgWkdrpLvsvSaWr 374
                           ++ +l++gWk+r L+++S W+
  Sobic.005G230900.1.p 611 DQRWLLQGWKGRVLFAISTWT 631
                           ********************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.225231611IPR005202Transcription factor GRAS
PfamPF035143.9E-99258631IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MEATPTPPSP TTVFLELQPP TACGMLMEKD SSSAHQDNDL VLPYISRLLM EDDIADKLFF  60
QQYDLDEPAL LEAQQPFIEI ISNAVVVPSR PCNNNYSGQP LVAPAPYTGT AESMAETNSL  120
LLPPETETES SCGMDAVSMA FFRGMEEANK FVPSIVVPRD RDRETVVDVD DSSRSRKKRH  180
ESEAAAEASK QMAAPESEEE ATAREMLDRL MLDGYNPSLA SDMNEAEEEE ETMTMSRSSG  240
RRRRSGTGTG TKHAVDMHTL LIRCAEAMSN NDWCAAAGLL ERIKYHSSPT GDSTQRLAHC  300
FAKGLEARLA GMGSQTYLSL VAKRASMVVV LKTYQLFMDS CCFLPVQLLF SNKTIYKAVA  360
GRKKLHIVDY GLGHGIQWPD LLRWLSRREG GPPEVRFTGI DKPQPGFRPA WPVEETGRRL  420
NACACQFGVP FQFRGVTKKK PGAIAVEDLD IDPDEVLVVN SMFHLETLMD ESIVVERPNP  480
RDVVLGTISK MRPSVFVHAI ANGSHSSAFF MARFRDALQR YSALFDMMDN IAPRDDDKRV  540
LVEQDIFARS ATSIIACEGV ERVVRPQNYK QWQARNQRAG LRQLPLDPEI VEALKDKVKK  600
EYHKCFVISE DQRWLLQGWK GRVLFAISTW TADS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-372616308374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450076.10.0hypothetical protein SORBIDRAFT_05g027820
TrEMBLC5Y1T00.0C5Y1T0_SORBI; Putative uncharacterized protein Sb05g027820
STRINGSb05g027820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-132GRAS family protein