PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G230800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 636aa    MW: 71952.5 Da    PI: 6.9444
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G230800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.21e-912586273373
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lL++cA+av+++d+ +a+ lL++++++as++gd++qRla++f+++L+arl++++s+l + + +++ s    +e l+a++l+  ++ + 
  Sobic.005G230800.1.p 258 SLLISCAQAVAANDHVRARDLLKQIKQHASETGDATQRLAHCFARGLEARLLGMGSQLWQLVLAERLS---IEEFLKAQNLYMAACSFN 343
                           79*********************************************************999888887...9***************** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           k+       +Il+a++g++r+Hi+D+++  G++W+ Ll+ LasR++gpp++RiT++ +++     +e +e tg+rL k A+  gvpf+f
  Sobic.005G230800.1.p 344 KVVICFSTMTILQAIQGKTRLHIVDYGMRFGFHWAHLLRLLASREGGPPKVRITAILRSRLRpcPAELIEDTGRRLIKCAHDSGVPFSF 432
                           *********************************************************977779999*********************** PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           +v + k++e++  e+L+ +p+E+l+Vn +++  +l+des   ++  +rd+vL+ ++++ P+v++ +  ++++ + s+l rf eal yy+
  Sobic.005G230800.1.p 433 HV-IRKKWEEVCNEDLDKHPDEVLVVNDHFNFSTLMDESIFFDNpsPRDTVLHNINKMMPDVFIQSILNSSY-GCSYLSRFKEALFYYT 519
                           *9.7***********************************97777669**********************999.679************* PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           a+fd+++a++pr s+ r+++E+ l+gr++vnv+aceg +  er e++++W++r ++aG++++pl+ k++ + k  +r+++ +   + ++
  Sobic.005G230800.1.p 520 AMFDMFDATMPRGSKPRMVLEQGLFGRAAVNVIACEGIDLLERPEKYRQWQARNQRAGLRQLPLQPKIVHTLKEEIRMCHHKDLLICQD 608
                           ********************************************************************************888****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaW 373
                            ++l++gW++r L+ +S W
  Sobic.005G230800.1.p 609 GHWLLQGWMGRILFGLSTW 627
                           ******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.309230608IPR005202Transcription factor GRAS
PfamPF035143.6E-89258627IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MAILKMIIRV YQIKEEFFVK DSMAQSPLSP SHEVFPRNPK QEAGGRSEGC HHHVPSDMMM  60
LPYISRMLME DEDDTDDKLL SDHPALLQVE QPFAQILSSP SPGDTNDGGG GDERSTPSYS  120
SLSRCPYAVV GEFLKGMDQA TNMLLPGAGG FICDDELQVN QTAARESRSK KRNNRDDHNL  180
QDEVITRSSK AVMTIKQQHE DICVHETMLE DMMSSGLETY IREFEKLRVD MANEAHQKNI  240
RKGGKKAVVS NNVVDVSSLL ISCAQAVAAN DHVRARDLLK QIKQHASETG DATQRLAHCF  300
ARGLEARLLG MGSQLWQLVL AERLSIEEFL KAQNLYMAAC SFNKVVICFS TMTILQAIQG  360
KTRLHIVDYG MRFGFHWAHL LRLLASREGG PPKVRITAIL RSRLRPCPAE LIEDTGRRLI  420
KCAHDSGVPF SFHVIRKKWE EVCNEDLDKH PDEVLVVNDH FNFSTLMDES IFFDNPSPRD  480
TVLHNINKMM PDVFIQSILN SSYGCSYLSR FKEALFYYTA MFDMFDATMP RGSKPRMVLE  540
QGLFGRAAVN VIACEGIDLL ERPEKYRQWQ ARNQRAGLRQ LPLQPKIVHT LKEEIRMCHH  600
KDLLICQDGH WLLQGWMGRI LFGLSTWVAQ GSSSE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-322605838328GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5034860.0AY503486.1 Sorghum bicolor clone 1218-SC0033 RFLP probe pSB1218.
GenBankAY5034770.0AY503477.1 Sorghum bicolor clone 1218-514605 RFLP probe pSB1218.
GenBankAY5034730.0AY503473.1 Sorghum bicolor clone 1218-257595 RFLP probe pSB1218.
GenBankAY5034720.0AY503472.1 Sorghum bicolor clone 1218-246712 RFLP probe pSB1218.
GenBankAY5034670.0AY503467.1 Sorghum bicolor clone 1218-102069 RFLP probe pSB1218.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450075.10.0hypothetical protein SORBIDRAFT_05g027810
TrEMBLC5Y1S90.0C5Y1S9_SORBI; Putative uncharacterized protein Sb05g027810
STRINGSb05g027810.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1981422
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-107SCARECROW-like 14