PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G230600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 585aa    MW: 66680.4 Da    PI: 6.698
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G230600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2991.2e-912075763373
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lL++cA+avs+++++ a++lL++++++as +gd++qRla++f+++L+arl++++ +l + l+ ++      +e l+a++l+  ++ + 
  Sobic.005G230600.2.p 207 TLLINCAQAVSASNFRTAHELLKQIKQHASATGDATQRLAQCFAKGLEARLMGTGRQLWQLLTLEQPL---AIEYLKAYNLYMATCSFN 292
                           79*********************************************************999888887...9***************** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           +++ +    +I  a+ g++++Hi+D++  +G+QW+ Ll+ +a+R++gpp++RiT++++ ++    +e +  tg+rL k A+e+gvpf+f
  Sobic.005G230600.2.p 293 RVALFFNVMTIEHAMVGKSKLHIVDYGPHHGFQWAGLLRWMANREGGPPEVRITAISRLQPRscPSEGTDDTGRRLDKCAREFGVPFKF 381
                           **********************************************************9999999************************ PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           ++ ++ ++e++++++L+++ +E+l+V   ++   l +e+   +    rd+vL+ +++++P+v++    +++h s+sFl+rf eal  ys
  Sobic.005G230600.2.p 382 HA-ITAKWETISIDDLKTEADEVLVVVDLFSFSILREENIYFDGlsSRDTVLNNIRKMRPDVFIQGIMNCSH-STSFLTRFREALFSYS 468
                           **.6999*******************999988888777776665668*************************.899************* PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           alfd+l+a++pr+s+ r ++E+ +lg ++ n+vacega+ ++r e++++W+ r ++aG++++pl+ +++k  k  + k + + + + e+
  Sobic.005G230600.2.p 469 ALFDMLDATIPRDSKLRPVLEQNMLGHSVLNLVACEGADVVNRPEKYRRWQVRNQRAGLRQLPLKPNIVKVLKDKVMKDHHKDFFISED 557
                           *************************************************************************9999998788****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaW 373
                            ++l++gW++r  ++ S W
  Sobic.005G230600.2.p 558 GQWLLQGWMGRIFYAHSTW 576
                           ******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.199179557IPR005202Transcription factor GRAS
PfamPF035144.1E-89207576IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MATTPEEFFM EGLMNLSPPS PSVLLDLPQM TNDVGQDSLC PDEIVLSYVS SVLMEDQSED  60
KLLCQDTDHP SLLQDCSGDQ CTLRSSLSIG ALAAGSVLKG MEEASRFLSE DNVFRKDQQL  120
NQMTRESGNS RVFKKRYNRD EDGEVGRAYK VFMMMEELEE MFDKMMLRGY ETCIEEMKKL  180
RITKADEAKN KKKGYNKRRS NVVDLYTLLI NCAQAVSASN FRTAHELLKQ IKQHASATGD  240
ATQRLAQCFA KGLEARLMGT GRQLWQLLTL EQPLAIEYLK AYNLYMATCS FNRVALFFNV  300
MTIEHAMVGK SKLHIVDYGP HHGFQWAGLL RWMANREGGP PEVRITAISR LQPRSCPSEG  360
TDDTGRRLDK CAREFGVPFK FHAITAKWET ISIDDLKTEA DEVLVVVDLF SFSILREENI  420
YFDGLSSRDT VLNNIRKMRP DVFIQGIMNC SHSTSFLTRF REALFSYSAL FDMLDATIPR  480
DSKLRPVLEQ NMLGHSVLNL VACEGADVVN RPEKYRRWQV RNQRAGLRQL PLKPNIVKVL  540
KDKVMKDHHK DFFISEDGQW LLQGWMGRIF YAHSTWVAED TISE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-3821153525337Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.005G230600.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021317864.10.0scarecrow-like protein 9
TrEMBLA0A1Z5RKD10.0A0A1Z5RKD1_SORBI; Uncharacterized protein
STRINGSb05g027795.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-110SCARECROW-like 14