PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G230500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 488aa    MW: 54500.2 Da    PI: 5.7606
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G230500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS165.35.1e-5115441410280
                  GRAS  10 eavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                           +av+ +d++ a  lL++++++as +gd+ qRla++f+++L+arla+++ +l k+l +++     + + l+a++lf  ++ ++k++    
  Sobic.005G230500.2.p 154 QAVAMNDHTVAVGLLKQIKQHASATGDAAQRLAHCFAKGLEARLAGTGMQLWKSLMAEHPI---VMDFLKAYSLFMAACCFHKIALKFS 239
                           68999***********************************************999999888...9************************ PP

                  GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                             +I +a+ g++ +Hi+D++         L+++La+R+ gpp++ iT++++ ++    ++++ee g rL+k A+e+g+pf+f+v ++k+
  Sobic.005G230500.2.p 240 IMTIEDAMVGKSSLHIVDYG---------LIRSLANRNVGPPQVTITAISHFQPRiyPAQQIEEQGCRLSKCAKEFGLPFKFHV-ITKK 318
                           ******************96.........9*********************999999**************************9.7*** PP

                  GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                           +ed+ +e+L+ +++E+l+Vn  l+  +l+d sv  +   +rd+vL+ +++++P +++ +  + +  ++sFl rf e l  y+alfd+ +
  Sobic.005G230500.2.p 319 WEDVFIEDLNKDTDEVLIVNDLLNFSSLMDVSVFFDAsnPRDTVLSNIRRMRPCIFIQSIVNRSS-GTSFLSRFRELLFNYMALFDMSD 406
                           ******************************9986554449**************99877766555.789******************** PP

                  GRAS 273 aklprese 280
                           a++pr+se
  Sobic.005G230500.2.p 407 ATMPRNSE 414
                           *****986 PP

2GRAS27.73.3e-09420486305371
                  GRAS 305 rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                            ++r e++++W+ r ++aG++++ l+ ++ k  k  ++k + + + + e+s++l++gWk+r L++ S
  Sobic.005G230500.2.p 420 LVNRPEKYMQWQVRNQRAGLRQLLLKPSIIKALKDEVKKEYHKDFFLTEDSQWLLQGWKGRVLFAHS 486
                           5789***********************************99888********************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098524.527119469IPR005202Transcription factor GRAS
PfamPF035141.8E-48154414IPR005202Transcription factor GRAS
PfamPF035141.1E-6420486IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MAITPEEFFA VDLMEMEPSP PSPSINLPLM PDGGGQGPLS DDDLVLTYIS GLLMEEDIDD  60
KLLGQYSDHP ALLQAQQSYA QLLSSPSFNA NSDNTFNSGN MEGAKNSLQG CSGDQYTLSS  120
SFSKGVDEEG QFSKGLEEAH RFLSGDNSFG KGEQAVAMND HTVAVGLLKQ IKQHASATGD  180
AAQRLAHCFA KGLEARLAGT GMQLWKSLMA EHPIVMDFLK AYSLFMAACC FHKIALKFSI  240
MTIEDAMVGK SSLHIVDYGL IRSLANRNVG PPQVTITAIS HFQPRIYPAQ QIEEQGCRLS  300
KCAKEFGLPF KFHVITKKWE DVFIEDLNKD TDEVLIVNDL LNFSSLMDVS VFFDASNPRD  360
TVLSNIRRMR PCIFIQSIVN RSSGTSFLSR FRELLFNYMA LFDMSDATMP RNSEFHGVDL  420
VNRPEKYMQW QVRNQRAGLR QLLLKPSIIK ALKDEVKKEY HKDFFLTEDS QWLLQGWKGR  480
VLFAHST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-1315641314277GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450072.10.0hypothetical protein SORBIDRAFT_05g027790
TrEMBLC5Y1S60.0C5Y1S6_SORBI; Putative uncharacterized protein Sb05g027790
STRINGSb05g027790.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.14e-85GRAS family protein