PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G230300.2.p
Common NameSb05g027785, SORBIDRAFT_05g027785
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 640aa    MW: 71133.5 Da    PI: 6.8194
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G230300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.11.3e-922446362373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                             lLl+cA+av+++d ++aq lLa+++ ++s +gd+ qR+a++f+e+L+arla+++s+ly++l  ++ts   +++ l a++l+  ++ +
  Sobic.005G230300.2.p 244 HALLLRCAQAVATDDRAAAQDLLAHIRRHSSATGDAAQRMAHCFAEGLEARLAGTGSRLYRSLMLRRTS---VADFLRAYRLYMAACCC 329
                           579***************************************************************999...***************** PP

                  GRAS  91 lkfshltaNqaIleavege........ervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakf 168
                            k+++   N++I +av+ +        +r+Hi+D+++++G+QWp Ll++La  ++gpp  +RiTg++ p++g   ++++e tg+rL++ 
  Sobic.005G230300.2.p 330 KKVAFTFSNKTIHDAVAVAggassrrrRRLHIVDYGLGYGFQWPGLLRSLAVMEGGPPeLVRITGIDLPQPGfrPARQIEDTGRRLSDC 418
                           ***************987666778888999*********************9998888689**********9*9*************** PP

                  GRAS 169 AeelgvpfefnvlvakrledleleeLrvkp.gEalaVnlvlqlhrll..............desvsleserdevLklvkslsPkvvvvv 242
                           A++lgvpf f+  +a + ed+++e+L+++p  E+l+V +  +   ll                +   +s+rdevL  +++++P+v+++ 
  Sobic.005G230300.2.p 419 ARQLGVPFAFRG-IAAKREDVSPEDLHIDPaAEVLVVISLCHFR-LLadeidiisgaavagPGRRRRPSPRDEVLGNIRRMRPDVFIHG 505
                           ************.69999************88888887777555.44599999999999764455556689****************** PP

                  GRAS 243 eqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331
                                ++++ F +rf ea+ yysa fd l+a++pr+s er  +Er ++gr+++nvvaceg++r+er et+++W+ r ++aG++++pl+ 
  Sobic.005G230300.2.p 506 VVSGGYGTTYFPTRFREAMFYYSAQFDLLDATVPRDSPERLLLERDIFGRAAMNVVACEGTDRVERPETYRQWQVRNQRAGLRQLPLEP 594
                           ***************************************************************************************** PP

                  GRAS 332 kaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                           +++k +   ++  + + + v+e++ +l+  Wk+r L+ +S W
  Sobic.005G230300.2.p 595 HVVKVVMDKVKDNYHRDFVVDEDQRWLLHRWKGRVLYGLSTW 636
                           **************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.335217617IPR005202Transcription factor GRAS
PfamPF035144.6E-90244636IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MAAAPLPPDD LFLVHPDPPS PSVFLDLPPA PPNDDDDMVL PYISHLLMEE EDAHAESFFY  60
QYPDHPALLH AQQPFADILA DVSSASASAT TSPSDDSDHS PTGNGRDANA ADMATSAFLK  120
GMQEATNLLP SVLSTNNSTL LLNHACKNSH AAARDDDGDP DPESRRAAKL MLPAEPADEA  180
DARRMFDQLM IHERDDICIK MKGVPQHQQQ GQGVDDDNPT QRRRRLRRRR STSTTSTDTV  240
VDLHALLLRC AQAVATDDRA AAQDLLAHIR RHSSATGDAA QRMAHCFAEG LEARLAGTGS  300
RLYRSLMLRR TSVADFLRAY RLYMAACCCK KVAFTFSNKT IHDAVAVAGG ASSRRRRRLH  360
IVDYGLGYGF QWPGLLRSLA VMEGGPPELV RITGIDLPQP GFRPARQIED TGRRLSDCAR  420
QLGVPFAFRG IAAKREDVSP EDLHIDPAAE VLVVISLCHF RLLADEIDII SGAAVAGPGR  480
RRRPSPRDEV LGNIRRMRPD VFIHGVVSGG YGTTYFPTRF REAMFYYSAQ FDLLDATVPR  540
DSPERLLLER DIFGRAAMNV VACEGTDRVE RPETYRQWQV RNQRAGLRQL PLEPHVVKVV  600
MDKVKDNYHR DFVVDEDQRW LLHRWKGRVL YGLSTWVAC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-402476368374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.92580.0shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270200.0KJ727020.1 Zea mays clone pUT4001 GRAS transcription factor (GRAS68) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450069.10.0hypothetical protein SORBIDRAFT_05g027785
TrEMBLC5Y1S30.0C5Y1S3_SORBI; Putative uncharacterized protein Sb05g027785
STRINGSb05g027785.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1707333
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-109GRAS family protein