PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G230200.1.p
Common NameSb05g027783, SORBIDRAFT_05g027783
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 718aa    MW: 78866.1 Da    PI: 5.9077
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G230200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS335.87.6e-1033357121373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lL++cA+av++g+   a+ lL++++e++sp+gd++qRla++f+++L+arla+++s++y + +  +   ++ +e l a++l+  ++ 
  Sobic.005G230200.1.p 335 LRTLLIHCAQAVAAGNRPSATDLLSKIRERSSPRGDATQRLAHCFAKGLEARLAGTGSQVYGSSSLMARG-YSAVELLRAYQLYLAACC 422
                           6789*********************************************************877666664.889*************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                           +  +++   N aI +a++g ++vHi+D++  +G+QWp+Ll   a +R++gpp++RiT+++ p++g   + +++etg+rL++fA++ gvp
  Sobic.005G230200.1.p 423 FTAMAFKFSNMAINKAIAGRKKVHIVDYGGHYGFQWPTLLGHWAnNREGGPPEVRITAIDLPQPGfrPAARIQETGRRLTNFARRHGVP 511
                           ******************************************997899****************9*9********************** PP

                  GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                           f+f+ ++a ++e++++++L+++++E+l+Vn  ++  +l+de ++++s  +rd vL  +++++P+v++++ +++++n++ F++rf ea+ 
  Sobic.005G230200.1.p 512 FRFHSIAAAKWETVSVDDLNIEHDEVLVVNGLFHFGKLMDEGADIDSlsPRDMVLGNIRKMRPDVFILCIENSSYNAPFFVTRFREAMF 600
                           ******999***********************************99999**************************************** PP

                  GRAS 263 yysalfdsleaklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                           +ysalfd+++a +pr++ +er+ vE+el+gr + n++aceg++r+er et+++W+ r e+aG+++++l+ +++k ++  ++  + + + 
  Sobic.005G230200.1.p 601 FYSALFDMMDAVAPRDDdDERVLVEQELFGRCALNAIACEGSDRVERPETYRQWQVRNERAGLRQLALDPDMVKGISKKVKDKYHKDFV 689
                           ***************99899*************************************************************999888** PP

                  GRAS 351 veeesgslvlgWkdrpLvsvSaW 373
                           ++ ++++l++gWk+r L+++SaW
  Sobic.005G230200.1.p 690 IDVDQQWLLQGWKGRILYAMSAW 712
                           *********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.137309693IPR005202Transcription factor GRAS
PfamPF035142.6E-100335712IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MAAEPAELAD SQPFSPSDFL SLPPTPRLDL DCPALQLQLQ DDDDDLVLPF ISRMLMEEDM  60
DGFFDPDHPA LLQAQQPFAD ILSDAAAAST TTKSSAGANS NSNAGNSRGT TLSPASAAGS  120
PAFANATWPY DPVDLSQLLL CRTYPDKLPA GNPAFANTDA LASSTMFGGG TVSMDMLNQA  180
FLKGMEEASK FLPATTTNSL LMPIVSGDGD HKKLWHVRQP KKTLVKPQVD GNGMPSSLLL  240
QQSASNGSSR GRKNNRHAGW GGDDLEEDET TGRRSCKLLA CETEEIEMVD EFVQSGYQTL  300
HEQMVAMTLS TDVDDKKSAT SRKGKKGSAN EAVDLRTLLI HCAQAVAAGN RPSATDLLSK  360
IRERSSPRGD ATQRLAHCFA KGLEARLAGT GSQVYGSSSL MARGYSAVEL LRAYQLYLAA  420
CCFTAMAFKF SNMAINKAIA GRKKVHIVDY GGHYGFQWPT LLGHWANNRE GGPPEVRITA  480
IDLPQPGFRP AARIQETGRR LTNFARRHGV PFRFHSIAAA KWETVSVDDL NIEHDEVLVV  540
NGLFHFGKLM DEGADIDSLS PRDMVLGNIR KMRPDVFILC IENSSYNAPF FVTRFREAMF  600
FYSALFDMMD AVAPRDDDDE RVLVEQELFG RCALNAIACE GSDRVERPET YRQWQVRNER  660
AGLRQLALDP DMVKGISKKV KDKYHKDFVI DVDQQWLLQG WKGRILYAMS AWVANGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-403397128374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.005G230200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450068.20.0scarecrow-like protein 14
TrEMBLA0A1Z5RK420.0A0A1Z5RK42_SORBI; Uncharacterized protein
STRINGSb05g027783.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5795422
Representative plantOGRP1981322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-144SCARECROW-like 14