PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G230000.1.p
Common NameSb05g027780, SORBIDRAFT_05g027780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 712aa    MW: 78462.8 Da    PI: 5.1426
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G230000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.31.4e-963217011373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lL++cAeavs+gd + a++lL ++++++sp+gd+ qRla++f+eAL+arla+    + + +++++ts +  ++ l a+kl+ ev+ 
  Sobic.005G230000.1.p 321 LRTLLTHCAEAVSTGDRRSATELLRQIRQRSSPRGDASQRLAHCFAEALEARLAG----TGALVAARRTSGSGGVDFLRAYKLYLEVCS 405
                           6789***************************************************....55556777777777**************** PP

                  GRAS  90 ilkfshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg..skeeleetgerLakfAeelg 173
                           +  +++  a  aI +a++    ++vHi+ ++  +Gl+Wp+Ll+a + +R++gpp++RiT ++ p++g   + ++eetg+rL++fA++ g
  Sobic.005G230000.1.p 406 FKMIAFKFAHIAICKAINITgrKKVHIVEYGDHHGLHWPPLLEAWSkDRDGGPPEVRITSIDCPQPGfrPAARIEETGRRLSDFARRRG 494
                           **99999999999999875544************************8899****************9*9******************** PP

                  GRAS 174 vpfefnvlvakrledleleeLrvkp....gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFler 256
                           vpf+f+ +va+++e++  ++L+++p    +E+l+Vn  ++  rl+de v++++  +rd vL+ +++++P+v++++ +++++n++ F++r
  Sobic.005G230000.1.p 495 VPFRFRSVVASKWETVCADDLDIEPddddDEVLVVNGLFHFGRLMDEGVDIDNtsPRDMVLRNIQKMRPDVFILCVENSSYNAPFFVTR 583
                           *************************9999********************9998889********************************* PP

                  GRAS 257 flealeyysalfdsleaklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                           f eal yysa+fd++e++ pr + eer  vE+ +lg  + n++aceg+er+er et+++W+ r ++aG+k++pl+ +++k   + ++  
  Sobic.005G230000.1.p 584 FREALFYYSAMFDMMETTTPRRDsEERLLVEQDILGACVLNAIACEGSERVERPETYKQWQVRGHRAGLKQLPLNPNTVKYLTRKVKDG 672
                           ****************999987769*************************************************************999 PP

                  GRAS 345 ksdgyrveeesgslvlgWkdrpLvsvSaW 373
                           + + + v+ ++++l++gWk+r L+++S W
  Sobic.005G230000.1.p 673 YHKDFVVDVDQQWLLQGWKGRILYAMSTW 701
                           9888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.403295682IPR005202Transcription factor GRAS
PfamPF035144.7E-94321701IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MAATPEDVAD PEPFSPSLFL DLPPTPHPHH PDGEGDGEDD LQVLPFISRM LMEEEGTDDD  60
AILYQEYPDH HPALLRAKQP FAQILSAPAA ATDSVSGPVT TNSAFDAFAD ATWPYDPVEL  120
SELLFSRTRS GTGVGVHGFT GGADAANSFS SPGPGVGQGS ASACGQARAF FNAGDTATIQ  180
SSSIGDGGVA VTMDMLNQAF LKGMEEANKF LPTTTTTIFG PDATSREHLP ISSVVDYGRV  240
SGRGCKNRHN WDDDDDDTGR RSNKLLAPEP EKNGEQVDAV FVQGYEMAIE KMHGLSISND  300
NNNNGKAKRK SASQGDEAVD LRTLLTHCAE AVSTGDRRSA TELLRQIRQR SSPRGDASQR  360
LAHCFAEALE ARLAGTGALV AARRTSGSGG VDFLRAYKLY LEVCSFKMIA FKFAHIAICK  420
AINITGRKKV HIVEYGDHHG LHWPPLLEAW SKDRDGGPPE VRITSIDCPQ PGFRPAARIE  480
ETGRRLSDFA RRRGVPFRFR SVVASKWETV CADDLDIEPD DDDDEVLVVN GLFHFGRLMD  540
EGVDIDNTSP RDMVLRNIQK MRPDVFILCV ENSSYNAPFF VTRFREALFY YSAMFDMMET  600
TTPRRDSEER LLVEQDILGA CVLNAIACEG SERVERPETY KQWQVRGHRA GLKQLPLNPN  660
TVKYLTRKVK DGYHKDFVVD VDQQWLLQGW KGRILYAMST WVADHTQLSQ S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-403217015374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450067.10.0hypothetical protein SORBIDRAFT_05g027780
TrEMBLC5Y8L80.0C5Y8L8_SORBI; Putative uncharacterized protein Sb05g027780
STRINGSb05g027780.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1981222
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-123SCARECROW-like 14