PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G229900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 675aa    MW: 74963.6 Da    PI: 5.7875
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G229900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS323.73.7e-992816622373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            +lL++cAeavs +d++ a +lLa++++l+sp+gd++qRla++f+e+L+arla+++s+ly++l +++++  +++e l+a++l+  vs +
  Sobic.005G229900.1.p 281 STLLIHCAEAVSMDDHATAAQLLAQIKKLSSPRGDANQRLASCFAEGLEARLAGTGSTLYSSLVAKRST--SVTEFLKAYQLYLAVSCF 367
                           579************************************************************999887..5***************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                              ++   N +I +a++g++++Hi+D+++ +G QWp+Ll+ La+R++gpp++R+T ++ pe+g   + ++ etg+rL+kfA+++g+pf+
  Sobic.005G229900.1.p 368 KMTAYRFSNMTISKAIAGKKKLHIVDYGVLYGCQWPNLLHYLANRRGGPPEVRMTCIDLPEPGfrPTARVDETGRRLSKFARQCGLPFK 456
                           **************************************************************999************************ PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrll.....desvsleserdevLklvksl......sPkvvvvveqeadhnsesFle 255
                           f+  +a ++e+++ ++L+++ +E+l+Vn++ + ++l+     d++ + +s+rd vL+ ++++       ++v++++  ++++ ++ F++
  Sobic.005G229900.1.p 457 FHG-IAAKWETVRADDLDIDADEVLVVNSINKFENLMdeagiDDDIHRPSPRDVVLRNIRKMmrppaaAADVFIHSVVNCSYATPFFVA 544
                           ***.799*****************************94444455566666*********9974333334699***************** PP

                  GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                           rf eal +ysa+fd+l+a+++r+s+ r+ vEr l+g+ + nvvacega+r+er et+++W++r ++aG++++p+  +a+k  +  +r+ 
  Sobic.005G229900.1.p 545 RFREALFHYSAMFDMLDATVSRDSDLRVAVERDLVGWCALNVVACEGADRVERPETYRQWQARNRKAGLRQLPFFPNAEKILREKMRNE 633
                           ***************************************************************************************99 PP

                  GRAS 345 ksdgyrveeesgslvlgWkdrpLvsvSaW 373
                           + + + ++ e+++l++gWk+r L+++S W
  Sobic.005G229900.1.p 634 YHKDFVIDVENNWLLQGWKGRILYAMSTW 662
                           9888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.558254643IPR005202Transcription factor GRAS
PfamPF035141.3E-96281662IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MAAAPEDGEP EPFSPSVFLD LPPTPRVEGD DDDPPLLTDD LVLPYISRML MEEDMDDDRF  60
FYHYPDHPAL LQAQQPFADI LSGSGSGSAN GSGTTFTPSS PSSSSSYVNV VVPAFATATW  120
PYDPLELTQR LTAGAAQEAG SQFFQSTDKG SQSRHVQNRV SMEDMINQAF LKGMEEANKL  180
LPGTSSSSSN KDGALLFGET NHGHGNSRGR RKNRRHDDFL EEGGETGRKS KLMAPEPEET  240
GEMVDKMVID GYNLCVNKMK TLSITTPTTK EVNNKNSSNL STLLIHCAEA VSMDDHATAA  300
QLLAQIKKLS SPRGDANQRL ASCFAEGLEA RLAGTGSTLY SSLVAKRSTS VTEFLKAYQL  360
YLAVSCFKMT AYRFSNMTIS KAIAGKKKLH IVDYGVLYGC QWPNLLHYLA NRRGGPPEVR  420
MTCIDLPEPG FRPTARVDET GRRLSKFARQ CGLPFKFHGI AAKWETVRAD DLDIDADEVL  480
VVNSINKFEN LMDEAGIDDD IHRPSPRDVV LRNIRKMMRP PAAAADVFIH SVVNCSYATP  540
FFVARFREAL FHYSAMFDML DATVSRDSDL RVAVERDLVG WCALNVVACE GADRVERPET  600
YRQWQARNRK AGLRQLPFFP NAEKILREKM RNEYHKDFVI DVENNWLLQG WKGRILYAMS  660
TWAAADDNTI SSEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-352846628374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450063.10.0hypothetical protein SORBIDRAFT_05g027750
TrEMBLC5Y8L30.0C5Y8L3_SORBI; Putative uncharacterized protein Sb05g027750
STRINGSb05g027750.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-128SCARECROW-like 14