PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G229600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 806aa    MW: 89117.3 Da    PI: 6.8199
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G229600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3304.5e-1014007703373
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lL++cA+av+ +d + a +lL+++++++sp+gd++qRla+yf+e+L+arla+s+s+ly++l +++ts    ++ l+a++l+  ++ + 
  Sobic.005G229600.1.p 400 TLLMHCAQAVAVDDRRSAAELLWKIKQHSSPRGDATQRLAHYFAEGLEARLAGSGSKLYNSLMAKRTS---AVDFLKAYRLYAAACCFR 485
                           79************************************************************999999...9***************** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                            +++   N +I ++++g +rvHi+D++i++G QWp Ll+ L+  p+gpp++RiTg++ p++g   + +++etg+rL+++A+++g+pf++
  Sobic.005G229600.1.p 486 VVAFKFSNMTICKSIAGRKRVHIVDYGIQYGSQWPGLLKCLSICPGGPPEVRITGIDLPQPGfrPASQVKETGRRLSNYASQVGMPFKY 574
                           *************************************************************9*9************************* PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           +  +a ++e++ +++L+++p+E+l+Vn++l+  +l+de  +++s  +rd vL+ +++++P+ +++   +  ++s+ F++rf eal +ys
  Sobic.005G229600.1.p 575 RG-IAAKWETVGVDDLDIDPDEVLIVNSILHFGNLMDEGIDTSSpsPRDVVLSNIRKMRPDAFILFVTNGTYSSPYFVQRFREALFHYS 662
                           **.799********************************988877779****************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           a+fd+++a+ pr+++ r+ vEr l+g+ ++nv+aceg +r+er et++kW+ r ++aG++++pl+ +++k ++  +r    + + ++ +
  Sobic.005G229600.1.p 663 AMFDMMDATTPRDNDLRVLVERDLFGQCAQNVIACEGLDRVERPETYKKWQLRNHRAGLRQLPLDPDIVKAVQESVRDKFHEDFVIDVD 751
                           *************************************************************************9999877788****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaW 373
                           +++l+ gWk+r L+++S W
  Sobic.005G229600.1.p 752 RQWLLGGWKGRILYAMSTW 770
                           ******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.25372751IPR005202Transcription factor GRAS
PfamPF035141.6E-98400770IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 806 aa     Download sequence    Send to blast
MHVQHEQIQN IVMYLVQCIV SLLCSSSKKI NKKIVGSHYF TLFQRSSLAG AWHKKTACLQ  60
IDVFSSLSRS KKKDSVFIHP RPTTTRPPSV AAMAASPEVF LPDLEEPFSP SVFLDLPPTP  120
RSDGNGDGKD PASDDIVLPF IERMLMEEGI DEEFLYQYPC HPALLQAQES YAQVLSEPTA  180
DSSSDGRLSV SVSSGSDAGV GADDLTADAI TASEQSPARL GDAGVRSDER PAQLGYAGTA  240
ARSDAAAEEE VEKKANSTML AVVDGLNSAF FSAQQDGGGK AMFLKGMEEA NKFLPRDIDL  300
LRGGSATVIQ VNEEESANGR GRENRHNRDG VLEANLGRES KMMAPEPEES GVVVDEMVAN  360
GFQLFFREME GLRISMGSEA EKKSRKGSVR SAKGVVDLCT LLMHCAQAVA VDDRRSAAEL  420
LWKIKQHSSP RGDATQRLAH YFAEGLEARL AGSGSKLYNS LMAKRTSAVD FLKAYRLYAA  480
ACCFRVVAFK FSNMTICKSI AGRKRVHIVD YGIQYGSQWP GLLKCLSICP GGPPEVRITG  540
IDLPQPGFRP ASQVKETGRR LSNYASQVGM PFKYRGIAAK WETVGVDDLD IDPDEVLIVN  600
SILHFGNLMD EGIDTSSPSP RDVVLSNIRK MRPDAFILFV TNGTYSSPYF VQRFREALFH  660
YSAMFDMMDA TTPRDNDLRV LVERDLFGQC AQNVIACEGL DRVERPETYK KWQLRNHRAG  720
LRQLPLDPDI VKAVQESVRD KFHEDFVIDV DRQWLLGGWK GRILYAMSTW AAADSMQLQQ  780
KEVVRFKITL PQNRSCQHCK KSSFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-404027708374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.215730.0leaf| shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450064.10.0hypothetical protein SORBIDRAFT_05g027760
TrEMBLC5Y8L40.0C5Y8L4_SORBI; Putative uncharacterized protein Sb05g027760
STRINGSb05g027760.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-141GRAS family protein