PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G229500.1.p
Common NameSb05g027750, SORBIDRAFT_05g027750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 690aa    MW: 76896.3 Da    PI: 5.2782
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G229500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS336.54.8e-1033096802373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            +lL++cA+av++++ + a++lL ++++++sp+gd++qRla++f+e+L+arla+s+s+ly++l +++ s   ++e l+a+ l+  ++ +
  Sobic.005G229500.1.p 309 STLLIHCAQAVATDNRRSATELLRQIKQHSSPKGDATQRLAHCFAEGLEARLAGSGSQLYRSLMAERVS---VVEYLKAYWLYLAACCF 394
                           579***********************************************************9999998...9**************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                              ++   N +Il+a++g ++vHi+ +++ +G+QWp+Ll  +a+ ++gpp++RiTg++ p++g   + ++eetg+rL+++A++lgvpf+
  Sobic.005G229500.1.p 395 KMTAFRFSNMTILKAIAGRKKVHIVNYGMDYGVQWPSLLYHMANLEGGPPEVRITGIDLPQPGfrPAMRIEETGHRLSNYARQLGVPFK 483
                           **************************************************************9999*********************** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           f+  ++ +++++++++L+++p+E+l+Vn+++q  +l+de v+++s  +rd vL+++++++P+ +++   +++++++ F++rf eal +y
  Sobic.005G229500.1.p 484 FHG-ITAKWDTVRVDDLNIDPDEVLIVNSIIQFGNLMDEGVNIDSpsPRDVVLRTIRKMQPDAFILYVMNVSYSAPFFVTRFREALFFY 571
                           ***.6999*********************************9999889***************************************** PP

                  GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrvee 353
                           sa+fd+l+a++pr+s++r  vE++l+++ + +vvaceg +r+er et+++W+ r ++aG++++pl+ + +k+ +  +r  + + + ++ 
  Sobic.005G229500.1.p 572 SAMFDMLDATAPRDSHQRFLVEQHLFRQCALSVVACEGMDRVERAETYKQWQVRNHRAGLRQLPLDPDLVKTLRDKVRDQYHKDFVIDT 660
                           *********************************************************************************888***** PP

                  GRAS 354 esgslvlgWkdrpLvsvSaW 373
                           ++++l+ gWk+r L+++S W
  Sobic.005G229500.1.p 661 DHNWLLEGWKGRILYAMSTW 680
                           ******************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.962282661IPR005202Transcription factor GRAS
PfamPF035141.7E-100309680IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MAASPEGEGL FVDPEPFSPS IFLDLSPTPR PDGNGEAPAS SDDLVLPFIS RILMEEDIDD  60
QFFYQFPDHP VLLQAQEPYA QILSDAAAAR TNSAASGSGS PATVSPSSSS DPAQLLLSPP  120
YPDAGLHDFT NDHVGTFFLP AQGGGSPEFE QSPAQLRTTT LPAGDGDHAA LASVFFKRED  180
ADAEMLNKAF LKGMEEAKKF LPTTNSLLID RGAEEVEEGI NGRCRKDRDR LSWDDLEAET  240
CRKSKLMVPE PEETGEMVDE MIVNGLKLCL KEMEALRITM GSEAKKKARK GKGKSAQGRS  300
SSNEAVELST LLIHCAQAVA TDNRRSATEL LRQIKQHSSP KGDATQRLAH CFAEGLEARL  360
AGSGSQLYRS LMAERVSVVE YLKAYWLYLA ACCFKMTAFR FSNMTILKAI AGRKKVHIVN  420
YGMDYGVQWP SLLYHMANLE GGPPEVRITG IDLPQPGFRP AMRIEETGHR LSNYARQLGV  480
PFKFHGITAK WDTVRVDDLN IDPDEVLIVN SIIQFGNLMD EGVNIDSPSP RDVVLRTIRK  540
MQPDAFILYV MNVSYSAPFF VTRFREALFF YSAMFDMLDA TAPRDSHQRF LVEQHLFRQC  600
ALSVVACEGM DRVERAETYK QWQVRNHRAG LRQLPLDPDL VKTLRDKVRD QYHKDFVIDT  660
DHNWLLEGWK GRILYAMSTW VADNPVSEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-433126808374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.82020.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450063.10.0hypothetical protein SORBIDRAFT_05g027750
TrEMBLC5Y8L30.0C5Y8L3_SORBI; Putative uncharacterized protein Sb05g027750
STRINGSb05g027750.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-147GRAS family protein