PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G229400.1.p
Common NameSb05g027740, SORBIDRAFT_05g027740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 731aa    MW: 81019.2 Da    PI: 4.9488
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G229400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS334.61.8e-1023507212373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            + L++cA+a+++gd + a+++L+++++++s +gd+ +Rla +f+e+L+arla+++s++y++l +++ts   ++e l+a+klf  +  +
  Sobic.005G229400.1.p 350 HTMLIHCAQAMATGDRRSATEMLKQIKQHSSLRGDASERLAYCFAEGLEARLAGTGSQVYQSLVAKRTS---VVEFLKAYKLFLAAISL 435
                           578***************************************************************999...***************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                            k+  +  N+ I+++v+g +++Hi+ +++++GlQWp Ll++La R++gpp++R Tg++ p++g   + ++eetg+rL++ A+e+gvpf+
  Sobic.005G229400.1.p 436 NKVHIFFSNRNIMDSVAGRSKLHIVAYGVQHGLQWPGLLNSLAGREGGPPEVRFTGIDLPQPGfrPAYQIEETGRRLSNCAREFGVPFK 524
                           **************************************************************99999********************** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           f++ +a ++e++  ++L+++p+E+l+Vn+  +  +l+desv+ +   +rd vL+ +++++P++++ + +    +++ Fl+rf eal yy
  Sobic.005G229400.1.p 525 FHA-IAAKWETICAKDLNIDPDEVLVVNSECHFSNLMDESVDADTpsPRDLVLNNIRKMQPNIFIQIVHSGTFGAPFFLTRFREALFYY 612
                           ***.799********************************998776669***************************************** PP

                  GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrvee 353
                           salfd+l+a++pr+++ r  +Er ++gr++ nv+acega+r  r et+++W+ r ++aG+k++pl+ +++k a+  ++k++ + + ++e
  Sobic.005G229400.1.p 613 SALFDMLDATIPRDNDVRLLIERDIVGRSALNVIACEGADRLDRPETYKQWQVRNHRAGLKQLPLNPEIVKLARDKVKKYYHKDFLIDE 701
                           *********************************************************************************889***** PP

                  GRAS 354 esgslvlgWkdrpLvsvSaW 373
                           ++ +l++gWk+r L+++S W
  Sobic.005G229400.1.p 702 DHRWLLQGWKGRVLFAMSTW 721
                           ******************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.629323702IPR005202Transcription factor GRAS
PfamPF035146.2E-100350721IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MSAAPEEFLA QGTYLAAPEP FSPSIFLDLP PTPRPDGDDP TSDDPASSDD LVLPFISRML  60
MEEDIDDKFF YQFPDHPALL SAQQPYAQIL SDATAASSSD SAAITSSGTG GSSTFSSSSS  120
APASADPTWP YDPIELSQLL RSPPYPDMGV GLDDFTADEV NAVFSPGQDA AFQPTFFGAQ  180
NGENMDMLNM AFLKGMEEAK KFLPTNNSLL INLDDTSGQS LPTDRDIKSS TAFVATQVKE  240
EEVSLKKKEE VDGISLFRGI SNGRGRKNHH SQEDLEVETG RNSKLMMPEQ EEAGASELFD  300
ELMSGKHDGF LKNMQDLRIA MDSESEKSAR RVSGKGARGK QHGNEFVDLH TMLIHCAQAM  360
ATGDRRSATE MLKQIKQHSS LRGDASERLA YCFAEGLEAR LAGTGSQVYQ SLVAKRTSVV  420
EFLKAYKLFL AAISLNKVHI FFSNRNIMDS VAGRSKLHIV AYGVQHGLQW PGLLNSLAGR  480
EGGPPEVRFT GIDLPQPGFR PAYQIEETGR RLSNCAREFG VPFKFHAIAA KWETICAKDL  540
NIDPDEVLVV NSECHFSNLM DESVDADTPS PRDLVLNNIR KMQPNIFIQI VHSGTFGAPF  600
FLTRFREALF YYSALFDMLD ATIPRDNDVR LLIERDIVGR SALNVIACEG ADRLDRPETY  660
KQWQVRNHRA GLKQLPLNPE IVKLARDKVK KYYHKDFLID EDHRWLLQGW KGRVLFAMST  720
WVAEDNNSIC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-403537218374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9760950.0EU976095.1 Zea mays clone 622740 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677823.10.0PREDICTED: scarecrow-like protein 34
TrEMBLC5Y8L20.0C5Y8L2_SORBI; Putative uncharacterized protein Sb05g027740
STRINGSb05g027740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-148SCARECROW-like 14