PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G209300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 498aa    MW: 57659.5 Da    PI: 7.7644
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G209300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS298.41.8e-911204903373
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lL++cA+a++ +d+ +a + L +++++as +gd++qRla++ft++L+ar+  ++ ++ + l +++ s    ++ l+a+ l+ +v+ +l
  Sobic.005G209300.2.p 120 TLLISCAQALAVDDHMRACEHLMQIKQHASATGDATQRLAHCFTKGLEARIGAKGRQIWQLLMSEHPS---LVDFLKAYDLYTKVCCFL 205
                           68*********************************************************999888888...9***************** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp.fe 177
                           k++++    +I++a+ g++r+Hi+D+++ +G+QW+ Ll+ LasR++gpp+++ T++++p+s    +e++e++g rL+k+A+elg p f+
  Sobic.005G209300.2.p 206 KVTFIFSTMTIMQAMVGKSRLHIVDYGMRYGFQWAGLLRLLASREGGPPEVKFTAIARPKSAyyPSEQIEKIGCRLKKYAHELGFPlFK 294
                           ************************************************************9999*********************979* PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           f++ +++++ed+++ +++++ +E+l+V+ +++   l++es   +s  +rd+vL+ +k+++P+v++ + ++ ++ ++sFl rf e l yy
  Sobic.005G209300.2.p 295 FHA-IMRNWEDISIMDMHTDDDEVLVVSDMFSFSILMEESIFFDSqsPRDTVLNNIKKMRPDVFIQSVSNRSY-GSSFLSRFREMLFYY 381
                           ***.7********************************99986665559*****************99999999.679************ PP

                  GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrvee 353
                           +alfd+l+a++pres+ r+++E+++lg  i n ++ceg + +er e++++W+ r ++aG++++pl+++++k ++  +rk++ + +++ +
  Sobic.005G209300.2.p 382 MALFDMLDATIPRESKSRSVLEQVVLGYYIFNDISCEGMDIVERPEKYRQWQTRNQRAGLRQLPLESSIVKAVEDEVRKHYHKDFMICQ 470
                           *********************************************************************************888***** PP

                  GRAS 354 esgslvlgWkdrpLvsvSaW 373
                           + ++l++gW+++ L + + W
  Sobic.005G209300.2.p 471 DGQWLLQGWMGHVLAAHTTW 490
                           *******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.63192471IPR005202Transcription factor GRAS
PfamPF035146.3E-89120490IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MEEANMFLLK DNNFSKDEQV NQIRESSVIG SRIKKRYNRD HLLEEEEEEV RSTSKAMMMI  60
KEPEEKCGNE MLEKMMLHVY DTCIIKGMER VTINNSGADK RNKKSRRIKT TRKNMVDIGT  120
LLISCAQALA VDDHMRACEH LMQIKQHASA TGDATQRLAH CFTKGLEARI GAKGRQIWQL  180
LMSEHPSLVD FLKAYDLYTK VCCFLKVTFI FSTMTIMQAM VGKSRLHIVD YGMRYGFQWA  240
GLLRLLASRE GGPPEVKFTA IARPKSAYYP SEQIEKIGCR LKKYAHELGF PLFKFHAIMR  300
NWEDISIMDM HTDDDEVLVV SDMFSFSILM EESIFFDSQS PRDTVLNNIK KMRPDVFIQS  360
VSNRSYGSSF LSRFREMLFY YMALFDMLDA TIPRESKSRS VLEQVVLGYY IFNDISCEGM  420
DIVERPEKYR QWQTRNQRAG LRQLPLESSI VKAVEDEVRK HYHKDFMICQ DGQWLLQGWM  480
GHVLAAHTTW VADDASS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-311224488330GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1849050.0KF184905.1 Saccharum hybrid cultivar R570 clone BAC 149L06 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002449961.10.0hypothetical protein SORBIDRAFT_05g026273, partial
TrEMBLC5Y7J20.0C5Y7J2_SORBI; Putative uncharacterized protein Sb05g026273 (Fragment)
STRINGSb05g026273.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1080039
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-110SCARECROW-like 14