PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G209200.1.p
Common NameSb05g026270, SORBIDRAFT_05g026270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 622aa    MW: 70830.3 Da    PI: 6.2885
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G209200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2852.1e-872416122373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL++cA+a++++d + +++lL++++++as +gd++qRla++f+ +L+ar+++s+s+l + l  +  s    +e l+a+klfsev+ +
  Sobic.005G209200.1.p 241 RRLLISCAQALAADDDKTTRELLKQIQQHASATGDATQRLAHCFAMGLEARIVGSGSQLLQRLMLEYPS---AIEFLKAYKLFSEVCCF 326
                           789**********************************************************99999998...9**************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp.f 176
                           ++++++    +I++a++g++r+Hi+D++   G+QW+ Ll+ Las+++g p+++iT++++p++     e++e++g rL+k A+elg+p f
  Sobic.005G209200.1.p 327 INVTFIFSAMTIMQAMAGKSRLHIVDYGTRFGFQWAGLLRLLASKKGGLPEVKITAIARPKPMchPGEQIEKIGCRLRKCAHELGLPsF 415
                           *************************************************************999999*******************66* PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                           +f++ ++k++ed  + +++++++E+l+V+ +++   l++es+  ++  +rd+vL+ +k+++P+v++    + ++ ++sFl rf +++ y
  Sobic.005G209200.1.p 416 KFHT-IMKNWEDTFIIDMHTDSDEVLVVSDMFSFGILMEESLFFDDpsPRDTVLHNIKKMRPDVFIQNVINRSY-GASFLSRFRDTVFY 502
                           ****.7**********************************997776669***************9988888777.789*********** PP

                  GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                           y+alfd+l+a++pr+s+ r  +E++llg ++ n ++ceg + +e  e++++W+ r ++aG++++pl++++ + +k  + k++ + +++ 
  Sobic.005G209200.1.p 503 YMALFDMLDATIPRDSKSRLLLEKVLLGCHAFNSISCEGMDLVEIPEKYKQWQTRNQRAGLRQLPLKSSILNVVKDEVMKHYHKDFMIS 591
                           **********************************************************************************888**** PP

                  GRAS 353 eesgslvlgWkdrpLvsvSaW 373
                           ++ ++l++gW++r + + + W
  Sobic.005G209200.1.p 592 QDGQWLLQGWMGRVICAHTTW 612
                           *******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.316214593IPR005202Transcription factor GRAS
PfamPF035147.2E-85241612IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MATTPEEFFI MDLMEQPPAS PPVFIDLPQK PNVSNEVRHR VPNDDMMLPY ISHMLMEDDI  60
DDELNNHPAL LQVQQPFAQI LSSHSLGTNT NNSEGANEFL HEGNGDEGAL NSPLSKGTCV  120
LGAYLKGMEE ANMLLHKDND IRRDELVINQ IRESNITDSW VRKRYNRDHL IEEEVRSANK  180
AVTRSKGPEE KHSNEMLDEM MLHSYETCIK GMEHVTMDNS EVEKRNMKSG RIKVARVVDI  240
RRLLISCAQA LAADDDKTTR ELLKQIQQHA SATGDATQRL AHCFAMGLEA RIVGSGSQLL  300
QRLMLEYPSA IEFLKAYKLF SEVCCFINVT FIFSAMTIMQ AMAGKSRLHI VDYGTRFGFQ  360
WAGLLRLLAS KKGGLPEVKI TAIARPKPMC HPGEQIEKIG CRLRKCAHEL GLPSFKFHTI  420
MKNWEDTFII DMHTDSDEVL VVSDMFSFGI LMEESLFFDD PSPRDTVLHN IKKMRPDVFI  480
QNVINRSYGA SFLSRFRDTV FYYMALFDML DATIPRDSKS RLLLEKVLLG CHAFNSISCE  540
GMDLVEIPEK YKQWQTRNQR AGLRQLPLKS SILNVVKDEV MKHYHKDFMI SQDGQWLLQG  600
WMGRVICAHT TWVANEDTSS E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-302446128374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1849050.0KF184905.1 Saccharum hybrid cultivar R570 clone BAC 149L06 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002449960.10.0hypothetical protein SORBIDRAFT_05g026270
TrEMBLC5Y7J10.0C5Y7J1_SORBI; Putative uncharacterized protein Sb05g026270
STRINGSb05g026270.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1080039
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-105GRAS family protein