PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G209100.1.p
Common NameSb05g026260, SORBIDRAFT_05g026260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 608aa    MW: 69129.6 Da    PI: 6.4179
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G209100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS285.41.6e-872275982373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL++cA+a++++++  a++lL++++++as +gd++qRla++f+++L+ar+++++s+l + l  +  s    +e l+a++l+se++ +
  Sobic.005G209100.1.p 227 RRLLISCAQALAADNHMTARELLKKIKQHASATGDTTQRLAHCFAKGLEARILGTGSQLWQLLMLEYPS---AVEFLKAYSLYSEACCF 312
                           789*********************************************************999888888...9**************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp.f 176
                           ++++++    +I++ + g++r+Hi+D++   G+QW  Ll+ Las+++  p+++iT +++p++   + e++e++g rL k A+elg+p f
  Sobic.005G209100.1.p 313 VNVTFIFSAMTIMQLMVGKNRLHIVDYGTRFGFQWTGLLRLLASKEGRLPEVKITIIARPKPIcfRGEQIEKIGCRLMKCADELGLPsF 401
                           *************************************************************9999*********************66* PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                           +f+  ++k++ed ++ +L+++++E+l+V   ++   l++es   +   +rd+vL+ +k+++P+v++    ++++ ++ Fl rf e+l y
  Sobic.005G209100.1.p 402 KFHS-IVKNWEDTSIMDLQTDTDEVLVVTDLFSFSILMEESIFFDApsPRDTVLNNIKKMRPDVFIQNVMNCSY-GSCFLSRFRETLFY 488
                           ****.7***************************999999997554444******************99999999.678*********** PP

                  GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                           y+alfd+l++++prese r ++E++llg  + n ++ceg++  er e++++W+ r ++aG+++++l+++++k +k  + k++ + +++ 
  Sobic.005G209100.1.p 489 YMALFDMLDTTMPRESESRLVLEKVLLGCYVFNGISCEGTDLLERPEKYNQWQTRNQRAGLRQLQLKSSIVKVVKNEVIKHYHKDFMIC 577
                           ****************************************************************************999999888**** PP

                  GRAS 353 eesgslvlgWkdrpLvsvSaW 373
                           ++ ++l++gW++r L + + W
  Sobic.005G209100.1.p 578 QDGQWLLQGWMGRVLSAHTTW 598
                           ********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.482200579IPR005202Transcription factor GRAS
PfamPF035145.5E-85227598IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MEQPPASPPV FPNLPQSPNV SNEACHHIPN NDMMLPYISH MLMEDDIDNE LSDHSALLQV  60
QQPFAQILSS HSLGTNTDHC EGPNEFLHEG RGDGSPHYSP LSKGSCVVGA YLKGMEEANM  120
LLPKGSIFRR DELVNQIRES NIIDSRVRKS YNKEHLLEEE VRTTNKAVMM NNELEEKCGM  180
IDKMMLHVYE TCIKGMESVN IDNTDVEKRN KNSGRIKAVR DNVVDIRRLL ISCAQALAAD  240
NHMTARELLK KIKQHASATG DTTQRLAHCF AKGLEARILG TGSQLWQLLM LEYPSAVEFL  300
KAYSLYSEAC CFVNVTFIFS AMTIMQLMVG KNRLHIVDYG TRFGFQWTGL LRLLASKEGR  360
LPEVKITIIA RPKPICFRGE QIEKIGCRLM KCADELGLPS FKFHSIVKNW EDTSIMDLQT  420
DTDEVLVVTD LFSFSILMEE SIFFDAPSPR DTVLNNIKKM RPDVFIQNVM NCSYGSCFLS  480
RFRETLFYYM ALFDMLDTTM PRESESRLVL EKVLLGCYVF NGISCEGTDL LERPEKYNQW  540
QTRNQRAGLR QLQLKSSIVK VVKNEVIKHY HKDFMICQDG QWLLQGWMGR VLSAHTTWVA  600
DEDASCG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-262305988374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1248253LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002449959.10.0hypothetical protein SORBIDRAFT_05g026260
TrEMBLC5Y7J00.0C5Y7J0_SORBI; Putative uncharacterized protein Sb05g026260
STRINGSb05g026260.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1080039
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-106GRAS family protein