PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G209000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 634aa    MW: 71626.3 Da    PI: 6.4307
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G209000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS287.83.1e-882476173373
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +l+++cA+ v+ +++++a++lL+++ ++as++gd++qRla++f ++L+arl++++s l + l +++ s   ++e ++a ++++e++ + 
  Sobic.005G209000.1.p 247 RLMISCAQEVAVNNHSRARELLKQIMQHASETGDATQRLAQCFSKGLEARLVGTGSLLWELLMAERPS---VVELIKASSVYYEACCFN 332
                           6899*************************************************999999988888887...9***************** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp.fe 177
                           k++ +    +I++a+ g++r+Hi+D++++   QW+ Ll++LasR++  p+++iT++g p+++   +e++ee+g rL +fA+e+g+p f+
  Sobic.005G209000.1.p 333 KMALVFSEVTIMQAMVGKSRLHIVDYGMEFAYQWAGLLRSLASREGALPEVKITAIGLPKPKsyPTEKIEEIGCRLGRFAHEFGLPsFK 421
                           **********************************************************9999999********************66** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                           f++ + +++ed  +e+L+++ +E+l+Vn  ++  +l de  s++   +rd vL+ + +++P+v++ +  ++++ ++sFl rf e l yy
  Sobic.005G209000.1.p 422 FHT-IKTNWEDACIEDLKIEADEVLVVNDLFSFSTLTDEIISIDGlsPRDIVLNNISKMRPHVFIQSVYNCSY-GSSFLSRFREMLLYY 508
                           ***.699********************************999998889*************************.678************ PP

                  GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrvee 353
                           +alfd ++a++pr+ + r+++E+++lgr++ n+v+cega+ +er e++++W++r ++aG++++pl++++++ +k ++ k++ + + + +
  Sobic.005G209000.1.p 509 TALFDIFDATIPRDCKSRMVLEQVVLGRSVLNAVSCEGADLVERPERYRQWQMRNQRAGLRQLPLKTSIVEIVKDMVMKHHHKDFLIFQ 597
                           *********************************************************************************888***** PP

                  GRAS 354 esgslvlgWkdrpLvsvSaW 373
                           + ++l++gW++r  ++ S W
  Sobic.005G209000.1.p 598 DGQWLLQGWRGRVHFAHSTW 617
                           ******************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.508219598IPR005202Transcription factor GRAS
PfamPF035141.1E-85247617IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MPLPARVFSW TPLSLPSRTI DQIKSPPFIL ATDPLTALPL ITMATTPEEF FCKGLMEQPP  60
PSPPVFTDDL PQEPNGSSEG QHHVVPNEMM LSYVSHVLLD DDIDEKLNNH PALLQGTYAV  120
GAFLKGMEEA NKFLPKDNNF RRDELLNHIV RESSSHSGVK KRHSRDRDDH LQLEITRTSK  180
AMTMTKEQEE NDLANEMLDE MMLHGYKACI RGMDKMCVTM DSEVEKKNMN SGSRKGMRDG  240
NVVDICRLMI SCAQEVAVNN HSRARELLKQ IMQHASETGD ATQRLAQCFS KGLEARLVGT  300
GSLLWELLMA ERPSVVELIK ASSVYYEACC FNKMALVFSE VTIMQAMVGK SRLHIVDYGM  360
EFAYQWAGLL RSLASREGAL PEVKITAIGL PKPKSYPTEK IEEIGCRLGR FAHEFGLPSF  420
KFHTIKTNWE DACIEDLKIE ADEVLVVNDL FSFSTLTDEI ISIDGLSPRD IVLNNISKMR  480
PHVFIQSVYN CSYGSSFLSR FREMLLYYTA LFDIFDATIP RDCKSRMVLE QVVLGRSVLN  540
AVSCEGADLV ERPERYRQWQ MRNQRAGLRQ LPLKTSIVEI VKDMVMKHHH KDFLIFQDGQ  600
WLLQGWRGRV HFAHSTWVAA DAASRGLGSS NAE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-292456174374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002449958.10.0hypothetical protein SORBIDRAFT_05g026250
TrEMBLC5Y7I90.0C5Y7I9_SORBI; Putative uncharacterized protein Sb05g026250
STRINGSb05g026250.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1080039
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-108GRAS family protein