PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G204600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family M-type_MADS
Protein Properties Length: 380aa    MW: 41804 Da    PI: 6.5537
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G204600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.92.4e-22953145
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                          kr en+s rqvt+skRr gilKKA+ELS+LCd++  +++fs+tgk
  Sobic.005G204600.1.p  9 KRLENSSGRQVTYSKRRSGILKKAKELSILCDIDLILLMFSPTGK 53
                          789****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.006153IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-30160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-26295IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-18323IPR002100Transcription factor, MADS-box
PfamPF003192.6E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MGRVKLKIKR LENSSGRQVT YSKRRSGILK KAKELSILCD IDLILLMFSP TGKPTICIGE  60
RSNIEEVIAK YAQLTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG GQTVEELSGH  120
LGSLQCQMAE VQKRLSYWSD PEKVENIDHI RAMEQSLKES LNRIQIHKEN FAKQHLIGLQ  180
CAAAQFQTDM QLPLGLTGEP GPSSWFQNGG ADGQQAMMLP DDSSLLHQRD IAGCSTSTSL  240
PGYPGYFSMT KQETDTGGGS EHAGQAAVHQ QPPPPPPDFS QAECLTSLHL GAQFPYAPCF  300
DHPSLFNDRM FRPDAVELHD GSAGMDFGGG HFDLPRPGDE ASFQNWASAA ACGAAMFDHH  360
HQQQQHHQQS QSSSAQQQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-13196194MEF2C
5f28_B1e-13196194MEF2C
5f28_C1e-13196194MEF2C
5f28_D1e-13196194MEF2C
6byy_A9e-14192190MEF2 CHIMERA
6byy_B9e-14192190MEF2 CHIMERA
6byy_C9e-14192190MEF2 CHIMERA
6byy_D9e-14192190MEF2 CHIMERA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.005G204600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021317428.10.0agamous-like MADS-box protein AGL65 isoform X2
SwissprotQ7X9I04e-90AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A1B6PTQ00.0A0A1B6PTQ0_SORBI; Uncharacterized protein
STRINGSb05g025970.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Representative plantOGRP59461119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.14e-82AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]