PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G123000.1.p
Common NameSb05g018070, SORBIDRAFT_05g018070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 423aa    MW: 45759.3 Da    PI: 7.6628
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G123000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4202e-128444211374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykal.ppsetsekn...........sse 76 
                           lv+lLl+cA++vs+gd+  a + L  l+  asp gd+mqR+a+yf+ ALaarl+  s ++ +++   + + +              s +
  Sobic.005G123000.1.p  44 LVHLLLACADFVSKGDQPSALRHLHLLRRVASPLGDSMQRVASYFADALAARLTLsSNPSSCSSSgGVATPRGGAgagvapytfppSPD 132
                           68***************************************************974444444444144444433378899999999999 PP

                  GRAS  77 elaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerL 165
                           +l++++++++++P++kf+h+taNqaI ea++ge+rvH++D+di qG QWpa+lqaLa+Rp+gpp+lR+Tgvg+     + +++etg+ L
  Sobic.005G123000.1.p 133 TLKIYQILYQACPYVKFAHFTANQAIFEAFHGEDRVHVVDLDILQGYQWPAFLQALAARPGGPPTLRLTGVGH----PSAAVRETGRHL 217
                           *************************************************************************....88********** PP

                  GRAS 166 akfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                           a++A++l+vpfef++ va+rle l++ +L+ + gEalaVn v +lhr++   v+l      +L+++++  Pk++++veqea hn++ Fl
  Sobic.005G123000.1.p 218 ASLAASLRVPFEFHAAVADRLERLRPGALQRRVGEALAVNAVNRLHRVP--GVHLGP----LLSMIRDQAPKIMTLVEQEAGHNGPYFL 300
                           ************************************************9..666666....**************************** PP

                  GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                            rfleal+yysa+fdsl+a++p++s  r+kvE+ ll++ei+nvvacegaer++rhe+l +Wr+ +e  GF+pvpls  a+ q + ll  
  Sobic.005G123000.1.p 301 GRFLEALHYYSAIFDSLDATFPADSAPRMKVEQCLLAPEIRNVVACEGAERVARHERLDRWRRLMEGRGFEPVPLSPAAVGQSQVLLGL 389
                           ***************************************************************************************** PP

                  GRAS 344 vk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           ++ +dgyr+ e++g+l+lgW+dr+++++SaWr
  Sobic.005G123000.1.p 390 YGaGDGYRLTEDKGCLLLGWQDRAIIAASAWR 421
                           *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.94718400IPR005202Transcription factor GRAS
PfamPF035146.8E-12644421IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MTTLQHQMAK SDQWAAAADS SLHSMLGSVI QAEAEQEQDS GLQLVHLLLA CADFVSKGDQ  60
PSALRHLHLL RRVASPLGDS MQRVASYFAD ALAARLTLSS NPSSCSSSGG VATPRGGAGA  120
GVAPYTFPPS PDTLKIYQIL YQACPYVKFA HFTANQAIFE AFHGEDRVHV VDLDILQGYQ  180
WPAFLQALAA RPGGPPTLRL TGVGHPSAAV RETGRHLASL AASLRVPFEF HAAVADRLER  240
LRPGALQRRV GEALAVNAVN RLHRVPGVHL GPLLSMIRDQ APKIMTLVEQ EAGHNGPYFL  300
GRFLEALHYY SAIFDSLDAT FPADSAPRMK VEQCLLAPEI RNVVACEGAE RVARHERLDR  360
WRRLMEGRGF EPVPLSPAAV GQSQVLLGLY GAGDGYRLTE DKGCLLLGWQ DRAIIAASAW  420
RC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A8e-863542010378Protein SCARECROW
5b3h_A7e-86354209377Protein SCARECROW
5b3h_D7e-86354209377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that functions in mycorrhizal specific signaling (PubMed:23122845). Required for Myc factor signaling from mycorrhizal fungi, but has no function in Nod factor signaling from rhizobial bacteria (PubMed:23122845). Regulates the expression of RAM2, a glycerol-3-phosphate acyl transferase that promotes cutin biosynthesis to enhance mycorrhizal hyphopodia formation (PubMed:23122845). {ECO:0000269|PubMed:23122845}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.005G123000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced in roots during colonization by arbuscular mycorrhizal fungi. {ECO:0000269|PubMed:23122845}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1363770.0AC136377.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBa0028G07, complete sequence.
GenBankAC1377590.0AC137759.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0008H02, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450783.10.0DELLA protein GAI
SwissprotG7L1660.0RAM1_MEDTR; GRAS family protein RAM1
TrEMBLA0A1Z5RI770.0A0A1Z5RI77_SORBI; Uncharacterized protein
STRINGSb05g018070.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92213141
Representative plantOGRP53661322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-104RGA-like 1
Publications ? help Back to Top
  1. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]
  2. Pecrix Y, et al.
    Whole-genome landscape of Medicago truncatula symbiotic genes.
    Nat Plants, 2018. 4(12): p. 1017-1025
    [PMID:30397259]